Zinc finger Ran-bind-->- Growth Factors, Growth Hormones, Purified Proteins, Dominant Negative Clones, Constitutively Active Clones- Lifeome

Company
Account
Cart: 1081 items : $1,019,083.90
- Total: $1,019,083.90CheckoutView Cart
- ALT/GPT ELISA, Mouse$860.00
- AGXT Antibody$75.00
- BNIP3$957.60
- CTXII ELISA, Horse$766.26
- LSM4 Human$75.00
- AFP ELISA, Bovine$748.44
- SSB IgG ELISA$250.00
- VEGF Mouse, Sf9$90.00
- EPO a Human, HEK$5,928.00
- TGF b 1 Human Recombinant$148.20
- RBP7 Human$90.00
- HSA$75.00
- PDCD6IP Human$75.00
- SNRPB2 Human$5,928.00
- Free Estriol ELISA$250.00
- pGH 22kDa Human$148.20
- FTH1 Human$75.00
- AKR1C1 Antibody$148.20
- SOX9 Human$558.60
- HBsAg adw$185.00
- SIRT3 Human$75.00
- TGF b 3 Human$90.00
- PDGF AA Human$90.00
- RAC3 Human$3,078.00
- LSM1 Human$3,078.00
- ANXA1 Human$2,052.00
- Myostatin Propeptide Human$5,335.20
- β-Lg ELISA, Rat$562.60
- PDCD4 Human$148.20
- Leptin Horse$1,083.00
- MYL12A Human$75.00
- CST9 Human$3,078.00
- HAV P3C$599.00
- MOG Human$75.00
- 6-keto-PGF1a ELISA, General$480.15
- SARS-CoV-2 Nucleoprotein IgG, Human$765.00
- SMAD3 Human$148.20
- HIV Type-O gp41$1,198.80
- DIRAS1 Human$75.00
- SNCA A30P Human$75.00
- HEV ORF2 (403-461 a.a.)$599.00
- IL 2 Porcine$90.00
- HSV-1 IgG ELISA$250.00
- Pigeon Albumin ELISA K-->$520.00
- MIF Human His C$2,052.00
- SMAD3 Human$2,565.00
- VEGF Mouse, His$90.00
- IL 3 Dog$90.00
- F8 Human$4,275.00
- LGALS3 Human$90.00
- pMEV2HA-P53-WT$672.00
- H1N1 New Caledonia$235.00
- IGFBP 4 Human$90.00
- TBEV NE$150.00
- TFF3 Human, His$148.20
- EIF1B Human$3,078.00
- A2M Human$148.20
- Omentin Human$148.20
- MYL1 Human$75.00
- Beta-Endorphin ELISA, Rat$926.00
- MIP 1a Human$90.00
- FSH ELISA$250.00
- VEGF (121 a.a.) Human$90.00
- IGF1 Human, GST$199.50
- Borrelia Afzelii OspC$3,596.40
- RAB1A Human$148.20
- BMP 2 Human, Monomer$148.20
- RAC1 Human$2,052.00
- KGF 2 Human$3,078.00
- Progesterone ELISA (Mouse/Rat)$550.00
- BMP 7 Human$148.20
- FsTnI Human$148.20
- pHTS-Neo-ISRE$540.00
- APOA1 Antibody$513.00
- Anthrax IgG ELISA$350.00
- C3a ELISA, Mouse$765.00
- IL 4 Porcine$90.00
- LAG-1 Human$3,078.00
- Chlamydia HSP70 (462-503 a.a.)$599.00
- U. Urealyticum$150.00
- MIP 1b Mouse$90.00
- FGF 9 Rat$4,001.40
- GM CSF Rat$148.20
- Ebola Sudan Protein$1,198.80
- TXN1 Human, His$148.20
- p53M Human$558.60
- B2M Human$1,539.00
- CDC37 Human$3,078.00
- a-Ovalbumin IgG ELISA, Mouse$765.00
- FGF1$1,083.60
- Rantes Human, His$90.00
- IL 2 Porcine$1,482.00
- CD11b Human$558.60
- Leptin Receptor Chicken$90.00
- Omentin Human, His$90.00
- ENA 78 Human (8-78 a.a.)$148.20
- SNRPD1 Human$75.00
- KIR3DL1 Human$4,104.00
- T.gondii p29$150.00
- AITRL Human$3,078.00
- S100A1 Mouse$90.00
- AIMP1 Human$1,368.00
- HSA Recombinant, Plant$95.00
- HAV P3C$999.00
- AGER Antibody Pair, Human$999.99
- HTNV$1,198.80
- Soybean P34$171.00
- CD11a Antibody$330.60
- NME3 Human$3,078.00
- ACTH ELISA, Fish$860.00
- POU5F1 Human, PolyR$148.20
- CDCA8 Human$148.20
- LB Agar Plate, Amp50$19.00
- pMEV2HA-BRAF-K482M$678.00
- IL 1 alpha Porcine$1,482.00
- FABP4 Human, His$150.00
- VEGF C Rat$90.00
- RAB14 Human$5,928.00
- ALK/P80 Antibody$90.00
- SOX2 Human$2,565.00
- HIV-1 gp120 CM$1,798.20
- IL 13 Rat$5,335.20
- Human IKK2, Set of 5$1,680.00
- HBV X$185.00
- IFNb ELISA, Rat$640.00
- Noggin Human$90.00
- SNCA A30P/A53T Human$148.20
- a1M$756.00
- Trypsin Human, Yeast$148.20
- SIRT2 Human$148.20
- HAV P3C$150.00
- Hepatitis B antibody$176.70
- BNP Human$5,335.20
- 4 1BBL Human$3,078.00
- APOA5 Human$90.00
- IL 8 Human (1-77)$90.00
- FGF 1 Mouse, His$90.00
- TPM2 Human$1,368.00
- BSA$228.00
- IP 10 Human, His$2,964.00
- IL10 ELISA, Rabbit$566.00
- Activin A Human$4,446.00
- ANGPTL3 Antibody$148.20
- ARHGEF25$907.20
- PFDN5 Human$75.00
- Activin B Human Plant-Active$1,710.00
- a2PI$793.80
- Brucella IgM ELISA$350.00
- CRYAB Mouse$148.20
- MIF Human$4,104.00
- GADD45G Human$148.20
- IFN g Mouse$90.00
- Ferritin ELISA$350.00
- HEV ORF2 (633-659 a.a.)$150.00
- SERPINA5 Human$75.00
- M.Pneumoniae P36$150.00
- Colipase ELISA, Pig$831.60
- BAFF Human, Plant$1,710.00
- Nephrin ELISA, Rat$860.00
- CSTB Human$148.20
- Transthyretin Human$90.00
- ANGPT2 Antibody Pair, Human$999.99
- MOG$148.20
- PRL R Rainbow Trout$148.20
- a-Actinin$148.20
- Clenbuterol Mab$301.50
- G CSF Mouse$90.00
- TFF2 Human$148.20
- β Manase ELISA, Mouse$562.60
- SDF 1a Rat$148.20
- TNNT2 Human$90.00
- DIRAS1 Human$5,928.00
- Streptavidin, His$3,078.00
- Hepatitis B antibody$330.60
- EG VEGF Human$148.20
- POU5F1 Human$5,928.00
- Free Testosterone ELISA$450.00
- FsTnI Human$3,420.00
- CD3 Antibody$330.60
- CXCL4 Variant 1 Human$90.00
- T.pallidum p41$150.00
- EBV EBNA1, His$799.99
- Norovirus Group-1$150.00
- Endoglin Mouse$148.20
- TGF b 1 Human$456.00
- CHIKV E1$185.00
- pMEV2HA-IkBa-DN$678.00
- VEGF (121 a.a.) Human, Sf9$90.00
- CRYAB Human$1,140.00
- Human KRAS2B, Set of 3$2,388.00
- EIF1AX Human$148.20
- ACTL6A Human$75.00
- HGF Human$148.20
- RAB17 Human$75.00
- EPGN Human$90.00
- Leptin Dog$90.00
- AURKB Antibody$513.00
- b4GALT1$907.20
- CLIC1 Human$148.20
- RGS2 Human$148.20
- SNAPIN Human$148.20
- COL4A3 Human$5,928.00
- APAF1$882.00
- IL 2 Antibody$176.70
- Growth Hormone (hGH) ELISA$350.00
- SARS-CoV-2 Spike Protein IgM ELISA$485.00
- CRYGD Human$90.00
- Activin A Human Plant$90.00
- Noggin Human, HEK$5,928.00
- SDF 1b Human$90.00
- Thrombin Porcine$798.00
- HPV 11$150.00
- Leptin Bovine$90.00
- SARS Core (1-49,192-220 a.a.)$150.00
- β-EPR ELISA, Mouse$562.60
- PGP9.5 Human, GST Tag$199.50
- EGF Human, Pichia$285.00
- VZV ORF26$599.00
- NAP 2 Antibody$330.60
- HBV HBe$599.00
- RAB1A Human$75.00
- HSV-2 VP13/14$150.00
- FGF 2 Bovine$90.00
- PFN1 Human$148.20
- β-CTx ELISA, Rat$562.60
- EGF Rat, Recombinant$90.00
- Acrp30 Antibody$75.00
- Leptin Mouse$148.20
- 8-epi-PGF2α ELISA, General$480.15
- Leptin Human$513.00
- BHMT Antibody$148.20
- SNRNP25 Human$4,104.00
- Leptin Horse$90.00
- dsDNA IgG ELISA$250.00
- EFNA1 Human$75.00
- TNF a Rabbit$148.20
- Lysozyme ELISA$450.00
- WNV Envelope$599.00
- EEF1D Human$5,928.00
- SNAP25 Human$75.00
- IL 8 Porcine$90.00
- LGALS2 Human$148.20
- Parvovirus B19 VLP VP1$150.00
- BCL2 Antibody$90.00
- TARC Human$90.00
- HIV-1 gag p17,p24, gp120$599.00
- APP Antibody$148.20
- GADD45GIP1 Human$5,928.00
- ALX4$907.20
- H1N1 California$235.00
- GST-HRP Antibody$1,482.00
- Cardiolipin IgA ELISA$250.00
- GH Human 20kDa$90.00
- pHTS-Neo-CRE$540.00
- Leptin Ovine$1,083.00
- MIA Human$90.00
- SDF 1b Human$148.20
- CD14 Mouse$199.50
- PDGF AA Human, Yeast$5,335.20
- CCKAR$957.60
- TNC Human$90.00
- SCF Mouse$3,078.00
- BSA$136.80
- MAPRE2 Human$148.20
- Ferritin ELISA$350.00
- FGF 2 Mouse$148.20
- LGALS2 Human$3,078.00
- CTGF Human, His$90.00
- Borrelia Afzelii OspA$185.00
- OTUB1 Human$3,078.00
- AFG3L2 Antibody Pair, Human$999.99
- CoVID19, Nucleic acid test$530.00
- SERPINA1 Human, Active$75.00
- Rubella Capsid$150.00
- RGS2 Human$75.00
- LTF ELISA, Dog$712.80
- APOB100$882.00
- CDC37 Human$296.40
- HMGB1 Human, Hi-5$148.20
- IL 15 Rat$90.00
- DDIT3 Human$148.20
- TRAF2 Human$75.00
- KIR2DL3 Human$4,104.00
- AURKB Antibody$75.00
- Beta-Endorphin ELISA, Horse$926.00
- Human NGAL Mab$301.50
- SNCA 1-60 Human$148.20
- CDCA8 Human$5,928.00
- Actin$1,710.00
- SMAD4 Human$75.00
- CALB2 Mouse$199.50
- C-Peptide ELISA, Pig$765.00
- RAC2 Human, 189a.a$75.00
- pHTS-Neo-MCS$540.00
- IL 15 Porcine$148.20
- MAPRE1 Human$75.00
- RPS14 Human$75.00
- β-EP ELISA, Rat$480.15
- SCGN Human$5,928.00
- pMEVHA-JNKK1-EE$678.00
- CD2 Human$307.80
- Borrelia Afzelii OspC$135.00
- Leptin Chicken$1,083.00
- RPS27A Human$148.20
- Activin B Human Plant-Active$148.20
- Hepc ELISA, Dog$752.40
- CCR6 Antibody$75.00
- CD11b Human$199.50
- Vimentin Human$148.20
- F7 Human$3,192.00
- RBP4 Human, His$90.00
- AFP Human$199.50
- EIF1B Human$75.00
- LB Agar Plate, Amp100$19.00
- EBV-VCA IgG ELISA$250.00
- FTL ELISA, Equine (Horse)$851.40
- Activin-A Human Plant-Active$1,710.00
- Der F1$171.00
- APP Antibody$513.00
- VEGF Human (121 a.a.), His Tag$2,052.00
- RPS14 Human$148.20
- CCL3L1$907.20
- AHA1 Human$148.20
- NANOG Human$3,078.00
- CHIKV Mutant$135.00
- Exosome Isolation Kit, 10 Isolations$999.00
- CD14 Antibody$330.60
- Endoglin Mouse$1,128.60
- HCV 4th Generation 65kDa$1,198.80
- BAFF R Human$90.00
- APOA1 Human$684.00
- HCV Core 22kDa, Fluorescein$299.00
- BAK1 Antibody$90.00
- Total Estrogens ELISA$450.00
- Leptin tA Ovine, PEG$148.20
- Estradiol ELISA (Mouse/Rat)$550.00
- H. Pylori IgA ELISA$250.00
- CRYBB1 Human$148.20
- SNRPB2 Human$75.00
- SNRNP25 Human$75.00
- HEV ORF2 (452-617 a.a.)$599.00
- Placental Lactogen Ovine$570.00
- RBP4 Human$90.00
- BHMT Antibody$75.00
- TPM2 Human$148.20
- scIC$90.00
- VEGF Human$4,001.40
- SDF 1a Mouse$148.20
- F9 Human$2,166.00
- AREG$1,058.40
- Cardiolipin Total Ab ELISA$250.00
- Dengue Envelope-1 22kDa$1,198.80
- 17-OHP ELISA, General$480.15
- VEGF Mouse, His$148.20
- TPM2 Human$75.00
- AREG$882.00
- GM CSF Mouse$148.20
- FGF 1 Mouse$148.20
- SNRPD Bovine$5,928.00
- KIR3DL1 Human$148.20
- KRT20 Human$148.20
- α2-PI ELISA, Mouse$562.60
- FGF 2 Rat$148.20
- VAMP5 Human$75.00
- VAMP5 Human$148.20
- IL 10 Porcine$90.00
- ProMark Native Protein MarkerRequest Quote
- EGF Rat, Recombinant$148.20
- VSNL1 Human, His$75.00
- DNAJB2 Human$75.00
- HSA Recombinant, Plant$342.00
- CP ELISA, Dog$712.80
- α-GST ELISA, Mouse$562.60
- RAB13 Human$75.00
- CLIC4 Human$4,104.00
- Dengue Virus IgM ELISA$350.00
- IP 10 Rat$3,078.00
- PF 4 Mouse$3,306.00
- Streptavidin-NC$798.00
- APOA1 Human$1,482.00
- AFP Human$307.80
- Leptin Porcine$90.00
- Endoglin Human, Sf9$148.20
- a-Actinin$2,850.00
- AFP ELISA$350.00
- B2M Human, His$148.20
- RGS16 Human$75.00
- DIRAS1 Human$148.20
- SNCA 61-140 Human$148.20
- MAGEA4 Human$2,565.00
- BRAK$907.20
- F5 ELISA, Pig$860.00
- HPV 16$150.00
- MV Large Polymerase 58-149 a.a$150.00
- LGALS3 Human$1,539.00
- ADAM12 Human$148.20
- F5 Human$684.00
- Leptin Bovine$148.20
- TFF2 Human$3,078.00
- SNRPD2 Human$75.00
- Brucella IgG ELISA$350.00
- MIP 3b Antibody$176.70
- CMV IgG ELISA$250.00
- a1AGP$748.44
- AMBP Human$148.20
- EEF1D Human$148.20
- HAV P2C-P3A$150.00
- MAP1LC3B2 Human$75.00
- HIV-1 gag p17,p24, gp120$150.00
- AITRL Human, His$148.20
- TFF2 Human$90.00
- CRYGD Human$3,078.00
- TBEV gE middle$999.00
- RGS19 Human$148.20
- KRT14 Human$5,928.00
- Insulin Human$1,140.00
- p53M Human$307.80
- CRH ELISA, Pig$748.44
- TARC Human$148.20
- HMGB1 Human$148.20
- SCF Human, Sf9$5,130.00
- BD 3 Antibody$176.70
- CD11b Antibody$176.70
- CAB39 Human$90.00
- IL 1 alpha Rat$90.00
- MIP 3 Antibody$176.70
- ATF Human$1,824.00
- EZCt Cells-2-Ct Direct$85.00
- CD14 Mouse$592.80
- CD4 Antibody$176.70
- VZV ORF26$150.00
- pMEV2HA-MEKK1-KD$354.00
- Borrelia DbpB$3,596.40
- GH Human, Plant$90.00
- HIV-1 gag p17,p24, gp120$1,198.80
- Human IkB alpha, set of 2$1,038.00
- TBEV Core$150.00
- AMY2 ELISA, Pig$782.02
- SCGN Human$148.20
- IL 1 beta Porcine$513.00
- TARC Human, His$148.20
- KRT14 Human$296.40
- RELM g Mouse$3,306.00
- α-CTx ELISA, Mouse$562.60
- ATF Bovine$570.00
- SNRPD Human$5,928.00
- MIF Human, Active$148.20
- Dengue Envelope-1 32kDa$1,198.80
- NAP 2 Human$90.00
- ANXA4 Human$148.20
- Zika NS1$599.00
- TNC Human$1,026.00
- AREG Human$90.00
- MIP 1a Rat$148.20
- CMV IgM ELISA$250.00
- LGALS10 Human$90.00
- TBEV gE C-end$599.00
- PRL R Human, GST$307.80
- Semaphorin 3D ELISA, Human$762.30
- HIF1A Human$148.20
- Kim1 ELISA, Dog$712.80
- MAP1LC3B Human$148.20
- GRO a Human, His$2,052.00
- IL 10 Rat$148.20
- G CSF Human, CHO$5,928.00
- TPM3 Human$148.20
- pMEV2HA-AKT1-DD$678.00
- Leptin tA Human$148.20
- IL 10 Mouse$90.00
- AHSG$148.20
- Flt3 Ligand Mouse$90.00
- CDC34 Human$148.20
- Dengue Envelope-1 & 4$1,198.80
- Myostatin Human$148.20
- APOA4$882.00
- CD63 ELISA, Rat$755.00
- IL 2r Antibody$330.60
- Duck Interleukin-4, IL--->$685.00
- NANOG-TAT Human$148.20
- FGF2 ELISA, Pig$748.44
- H. Pylori IgM ELISA$250.00
- VZV gE$999.00
- HMGB1 Human, Hi-5$75.00
- Dynorphin ELISA, Rat$860.00
- DYNLRB2 Human$3,078.00
- Angiostatin K1-4$148.20
- HBeAg$2,697.30
- FGF 2 Bovine$148.20
- BrdU Antibody$176.70
- HAV VP1$599.00
- pMEV2HA-IRAK1-KA$816.00
- LIF Human, GST$5,928.00
- Collagen-III Human$245.10
- Borrelia Afzelii BmpA$185.00
- RAB13 Human$5,928.00
- TXN1 Human$75.00
- OSTF1 Human$148.20
- Androstenedione ELISA$250.00
- SNAP25B Human$75.00
- Omp Pylori$171.00
- Lymphotactin Human, His$5,928.00
- GRO b Human$90.00
- ANXA4 Human$5,928.00
- AMH$882.00
- Free PSA ELISA$350.00
- ProMark Native Protein MarkerRequest Quote
- EGF Mouse$148.20
- ISG15 Human$148.20
- EFNB1 Human$75.00
- Chlamydia trachomatis IgM ELISA$250.00
- KIR2DL1 Human$148.20
- BAFF Human$148.20
- GADD45GIP1 Human$148.20
- Activin A Human$148.20
- APOA1$907.20
- HCV 4th Generation 65kDa$599.00
- IGFBP 6 Human$148.20
- IL 8 Rabbit$90.00
- DDIT4 Human$148.20
- SDC4 Human, His$2,052.00
- IL 10 Antibody$330.60
- ANXA11 Human$148.20
- BNP ELISA, Dog$712.80
- CSTB Human$4,104.00
- SNCA A53T Human$75.00
- HSV-1 gG$599.00
- HMGA1 Human$75.00
- CD11b Antibody, FITC$285.00
- CRISPR-Gene Specific Duo Set-for KI$1,155.00
- Leptin tA Human$90.00
- TFF3 Human, His$90.00
- Omp Pylori$1,368.00
- HIV Type-O Envelope$999.00
- I TAC Human$90.00
- HPCAL1 Human$75.00
- APOA1 Human$148.20
- AngII ELISA, Bovine$748.44
- NSE ELISA, Human$801.90
- SARS-CoV-2 N Protein IgM ELISA$485.00
- SARS Core (1-49 a.a.)$599.00
- TXN1, His$148.20
- HSP90 ELISA, Bovine$748.44
- DNAJB11 Human$1,368.00
- GM CSF Human, His$2,736.00
- Dengue Envelope 2 14kDa$185.00
- GADD45B Human$2,052.00
- Fentanyl ELISARequest Quote
- BAFF ELISA, Pig$790.02
- ANXA3 Human$2,565.00
- SEPT2 Human$5,928.00
- CYP1A1 ELISA, Simian$891.00
- B2M Human Recombinant$148.20
- AIF1L Human$90.00
- Insulin ELISA (Mouse/Rat)$550.00
- Flt3 Ligand Human$90.00
- CD14 Antibody, FITC$285.00
- AP2M1 Antibody Pair, Human$999.99
- MYL6 (1-208 a.a.) Human$3,078.00
- HMGB2 Human$4,104.00
- LIF Human, GST$90.00
- VZV gE$150.00
- Leptin tA Ovine$148.20
- REG4 Human$148.20
- Visfatin Mouse$90.00
- RPLP1 Human$75.00
- HMGA1 Human$148.20
- T.gondii p29$599.00
- FGF 2 Bovine$330.60
- α-Glu ELISA, Human$562.60
- Trypsin Human$75.00
- LFA 3 Human$90.00
- FGF 1 Human$1,539.00
- α1-MG ELISA, Mouse$562.60
- Zika Envelope$599.00
- VSNL1 Human$2,052.00
- Leptin Receptor Human$148.20
- KRT14 Human, His$148.20
- PDGF AB Human$148.20
- MAP1LC3B2 Human$3,078.00
- IGFBP 5 Human$3,306.00
- IL 1 beta Porcine$3,420.00
- C-10 Rat$90.00
- Endoglin Human$199.50
- ALX4$882.00
- SARS Envelope$150.00
- MIP 1a Human, His$2,964.00
- Human Cardiac Troponin I Mab$301.50
- PDCD5 Human$4,104.00
- ACPP Antibody Pair, Human$999.99
- MAPRE3 Human$75.00
- ADAM10 Human$5,472.00
- EPO a Fc Human$148.20
- GM CSF Rat$90.00
- APO D Human, GST$199.50
- CD11b Antibody, Biotin$285.00
- I TAC Human, His$3,078.00
- Estradiol ELISA$250.00
- IL 10 Human$90.00
- KGF Human, HEK$1,254.00
- Apo D Human$148.20
- IL 1 alpha Mouse$90.00
- TNF a Porcine$5,928.00
- Leptin tA Ovine$1,915.20
- SNCA A30P Human$148.20
- Activin-A Human, HEK-Active$148.20
- CALB1 Human$148.20
- TRAF2 Human$148.20
- TPM3 Human$75.00
- OPG Fc Human$90.00
- IL 1 beta Rat$5,335.20
- Resistin Human$148.20
- FGF 18 Mouse$90.00
- CCL16 Human$90.00
- GH Antagonist Chicken$148.20
- LB Agar Plate, Amp/Kan$20.00
- TNC Rabbit$148.20
- Leptin tA Mouse$148.20
- ARL1 Human$3,078.00
- EBNA1BP2 Human$185.00
- FGF 19 Human$90.00
- 5-HT ELISA, General$788.00
- HA Antibody$741.00
- Leptin tA Ovine$90.00
- SCGN Rat$75.00
- OPG Human, Hi-5$90.00
- T.gondii p29$999.00
- pGH 20kDa Human$2,394.00
- COX4I1 ELISA, Mouse$712.80
- RGS21 Human$75.00
- SMAD4 Human$148.20
- FABP3 Human$4,104.00
- BRAK Human$3,078.00
- α-La ELISA, Human$562.60
- ADFP Human$5,928.00
- SARS Matrix$599.00
- PF 4 Human$3,078.00
- IGF1 Rat$1,539.00
- S100A10 Human$5,472.00
- REG1B Human$75.00
- BMP4$907.20
- GRO b Human, His$3,078.00
- HBV core delta$150.00
- BMP2 ELISA, Rabbit$860.00
- F8 Human$1,014.60
- LGALS3 Human, His$148.20
- Cystatin C Human$148.20
- Myoglobin Human$1,482.00
- pMEVHA-P38G-WT$678.00
- M.Pneumoniae P1-C$599.00
- T.pallidum p41$999.00
- CD40L ELISA, Dog$712.80
- CRYAB Mouse$90.00
- HAV VP1-P2A (669-782 a.a)$599.00
- FLAG Antibody$330.60
- TNC Rabbit$558.60
- HBV X$3,696.30
- AES Human$148.20
- MYL5 (1-173 a.a.) Human$75.00
- GM CSF Porcine$90.00
- Norovirus Group-2$1,198.80
- BAG1 Human$90.00
- IGF1 Human Des1-3$148.20
- pMEV2HA-OCT3/4$678.00
- GH Ovine$90.00
- FGF 21 Mouse, His$148.20
- IL 15 Porcine$1,482.00
- T.pallidum p41 Mosaic$999.00
- A2LD1 Human$75.00
- FGF 2 Bovine$1,436.40
- NT-ProBNP ELISA, Chicken$742.50
- TXN1 Yeast$148.20
- Cortisol ELISA (Saliva)$300.00
- Insulin Human, Yeast$90.00
- GRO a Human$3,078.00
- HSV-1 gG$150.00
- IGF1 Rat$90.00
- SHH Mouse, His$90.00
- PCNA Human, Sf9$3,990.00
- MAP1LC3B2 Human$148.20
- ACTL6A Human$148.20
- Avidin Biotin$148.20
- GH Rat$290.70
- GH Gilthead Seabream$290.70
- SDCBP Human$148.20
- Duck growth hormone gr-->$860.00
- Vimentin Human$75.00
- HBsAg adr$185.00
- ALK/P80 Antibody$513.00
- CCL28 Mouse$148.20
- EBV p18, GST$1,498.50
- H1N1 Solomon Islands$185.00
- GH Denis$148.20
- Myostatin Human$90.00
- MBP Antibody$75.00
- PRL R Human$3,830.40
- αHBDH ELISA, Human$562.60
- STMN3 Human$5,928.00
- VEGF E (Orf Virus)$5,814.00
- Leptin tA Ovine, PEG$3,830.40
- LSM4 Human$148.20
- TXN1 Human$2,052.00
- pMEV2HA-KLF4$678.00
- EPO a Fc Human$5,472.00
- Zika NS1$1,198.80
- Activin-A Human Plant-Active$90.00
- ARF4 Human$90.00
- Eptifibatide Human$444.60
- VAMP1 Human$75.00
- PFN1 Human$2,052.00
- S100A10 Human$148.20
- GHBP Human$3,830.40
- CALM2 Human$4,104.00
- KRT20 Human$90.00
- Vimentin Bovine$148.20
- IP 10 Rat$148.20
- CALPRO ELISA, Dog$792.00
- F7 Human$148.20
- LGALS13 Human$148.20
- p53M Human$199.50
- CENPA Human$148.20
- ARF3 Human$148.20
- MIP 1a Human, His$90.00
- FGF 1 Human$148.20
- FGF 2 Human, sf9$5,928.00
- RGS19 Human$3,078.00
- FGF 2 Mouse$90.00
- CCKAR$1,058.40
- HIF1A Human, His$75.00
- IL 1 beta Mouse, His$3,078.00
- PDGF B Human$90.00
- IL4 ELISA, Simian$801.90
- IFN tau Ovine$148.20
- HSA Recombinant, HEK$1,368.00
- CLIC1 Human$2,565.00
- CAB39 Human$5,928.00
- BNP Human$1,710.00
- Human P53, Set of 2$1,032.00
- Leptin Mouse$513.00
- CRYBB1 Human$2,565.00
- HTF Bovine$570.00
- H1N1 Taiwan$1,998.00
- HMGB2 Human$75.00
- BMP 2 Human$90.00
- BMP 4 Human, Active$1,150.00
- GST antibody$285.00
- Trypsin Human, Yeast$75.00
- FGF 9 Rat$90.00
- CLIC2 Human$148.20
- SOD Human$75.00
- α2-M ELISA, Rat$562.60
- BDNF Antibody$176.70
- His Tag Antibody$330.60
- Norovirus Group-2$150.00
- GHBP Ovine$3,830.40
- RAC3 Human$148.20
- VEGF C Human$90.00
- T.pallidum p41$599.00
- IL 1 beta Monkey$3,990.00
- ANGPTL4 Human, HEK$148.20
- Activin A Human Plant$148.20
- FABP3 Human, His$148.20
- α1-AGP ELISA, Chicken$630.50
- CDC34 Human$3,078.00
- HSA Recombinant, HEK$148.20
- Free Triiodothyronine (fT3) ELISA$250.00
- AK3L1 Antibody$148.20
- Zika Envelope$1,198.80
- ARHGEF25$957.60
- Pro-Insulin ELISA$490.00
- Chimeric Chagas$299.05
- Beta-Endorphin ELISA, Mouse$905.00
- TPO Human, CHO$90.00
- TBEV Core$599.00
- EGF Mouse$256.50
- ANXA11 Human$90.00
- HA-HRP Antibody$1,482.00
- MIF Human His C$148.20
- pMEV2HA-MEK1-DN$678.00
- Hippo Pathway trans-Reporting System$828.00
- CENPH Human$3,078.00
- I TAC Human$3,078.00
- EPO a Human$148.20
- EBV p18$999.00
- NANOG-TAT Human$75.00
- Leptin Chicken$90.00
- AHSA1 Antibody Pair, Human$999.99
- p53 Human, GST$558.60
- IGFBP 3 Human$3,078.00
- TGF b 1 Human, GST$148.20
- AKR1C1 Antibody$513.00
- KGF 2 Human$90.00
- CCL28 Rat$3,078.00
- IL 4 Antibody$176.70
- CD23 Human$199.50
- 1F8 Chagas$135.00
- CD4 Antibody, Biotin$456.00
- ARF3 Human$3,078.00
- AIF1L Human$148.20
- KRT18 Human, His$5,472.00
- Brucella Antibody ELISA, Dog$926.00
- TPO Human, CHO$4,446.00
- Bcl 2 Human$5,472.00
- HBV core (1-183 a.a.)$599.00
- RBP4 Human$148.20
- Myostatin Human, Plant$90.00
- GST antibody$330.60
- SNAP25B Human$3,192.00
- Rubella Capsid$999.00
- CDC25A Human$148.20
- MDC Mouse$148.20
- SERPINB5 Human$148.20
- Leptin Dog$148.20
- RAC2 Human, 189a.a$148.20
- B220 Antibody$176.70
- PSA ELISA$350.00
- aFGF Bovine$2,143.20
- SCF Human, Sf9$148.20
- Dengue Envelope-1 15kDa$150.00
- FABP3 Human, His$75.00
- CTGF Human, HEK$1,140.00
- F3 Human$5,472.00
- FABP3 Human$148.20
- Streptavidin$75.00
- CDC34 Human$90.00
- ABCB10$882.00
- BAFF Human, His$90.00
- PDGF AA Human, Yeast$90.00
- RELM g Mouse$90.00
- HBV AG-2 antibody$176.70
- Dengue Envelope-1 15kDa$1,198.80
- FABP4 Human, His$2,850.00
- Activin-A Human Plant-Active$148.20
- MAPRE3 Human$3,078.00
- Chlamydia W2$1,198.80
- PRL R Human$148.20
- KRT18 Human$4,104.00
- TFF2 Human, His$90.00
- HEV Mosaic$999.00
- BID Antibody$90.00
- Chlamydia PGP-3D$1,198.80
- GRO b Human$148.20
- HTNV$599.00
- Anti-CCP-ab ELISA, Mouse$765.00
- Apo-A1 ELISA, Rabbit$728.00
- AngII ELISA, Simian$801.90
- IGF1 Gilthead Seabream$148.20
- S100A1 Mouse$148.20
- SARS Envelope$599.00
- DHH Human$148.20
- HPV 16$599.00
- BAG2 Human$90.00
- LeukinFeron Human$273.60
- Borrelia BmpA$135.00
- EBV p18$599.00
- JEV$599.00
- AMH ELISA, Pig$748.44
- bLg$1,058.40
- Myostatin Human, Plant$148.20
- HDGF Human$148.20
- GRO b Mouse$148.20
- AREG$957.60
- IL 11 Human, Pichia$90.00
- FGF 1 Human, Sf9$5,928.00
- Ephrin A4 Human$199.50
- MYL2 Human$148.20
- ANXA5 Antibody Pair, Human$999.99
- SDF 1a Human, His$3,306.00
- ATF Human$912.00
- RAC1 Human, His$2,052.00
- CTGF Human$148.20
- scIC$5,928.00
- FGF 2 Bovine$216.60
- Dengue Envelope-1 32kDa$599.00
- VEGF Rat$148.20
- PDCD5 Human$148.20
- VEGF C Human$148.20
- Leptin Pufferfish$1,197.00
- TBEV gE C-end$150.00
- SOX9 Human$307.80
- IGFBP 1 Human$558.60
- HCV Core 1-120$2,697.30
- FsTnI Human$180.00
- MIP 1a Rat$3,078.00
- Myoglobin Human$75.00
- LGALS14 Human$90.00
- TNNT2 Human$148.20
- CALB1 Rat$90.00
- Leptin Human, His$148.20
- Activin A Human$90.00
- PDCD6IP Human$296.40
- BCA 1 Human$148.20
- Beta-Endorphin ELISA, Canine$926.00
- CDC37 Human, His$5,928.00
- Transferrin Human$399.00
- LGALS3 Human, His$180.00
- BrdU Antibody$661.20
- PDCD6 Human$150.00
- SIRT3 Human$296.40
- ARF4 Human$4,104.00
- ANXA2 Human$90.00
- REG3A Human$75.00
- MAP1LC3A Human$148.20
- SCF Mouse$148.20
- VEGF Mouse, Sf9$5,814.00
- GST antibody$176.70
- HBsAg adr$135.00
- PF 4 Mouse$148.20
- CABP7 Human$90.00
- BD 3 Human$148.20
- Ebola Zaire GP$1,198.80
- M.Pneumoniae P116$150.00
- VEGF C Rat (152 a.a.)$148.20
- CD4 Antibody, FITC$456.00
- b2M ELISA, Simian$801.90
- HSV-2 gG$599.00
- PCNA Human, GST$307.80
- VZV ORF26$999.00
- PRL R Rat$3,830.40
- SARS Envelope$999.00
- pMEV2HA-BRAF-V599E$678.00
- PF 4 Human$3,078.00
- VSNL1 Human$148.20
- DnaJ Human$3,078.00
- H1N1 New Caledonia$1,798.20
- Trypsin Bovine$148.20
- ISG15 Human$2,052.00
- ACTG1 Human$75.00
- PDGF AA Human, HEK$90.00
- FGF 21 Bovine$5,928.00
- CDC26 Human$148.20
- EBNA1BP2 Human$135.00
- AK3L1 Antibody$513.00
- GHBP Bovine$3,830.40
- 1,5-AG ELISA, General$799.00
- Kanamycin Mab$301.50
- Zika NS1, HEK$185.00
- pMEVHA-IKK2-AA$678.00
- Norovirus Group-1$1,198.00
- CTGF (182-250 a.a.) Human$2,736.00
- C 10 Mouse$90.00
- PRL R Human$90.00
- pMEVHA-IKK2-EE$678.00
- aLA ELISA, Dog$752.40
- AGXT Antibody$148.20
- DNAJB2 Human$5,928.00
- GADD45A Human$2,565.00
- MYL12A Human$3,078.00
- Morphine ELISA (Canine)$550.00
- TNI Human$148.20
- GM CSF Monkey$3,334.50
- IGF1 Mouse$1,436.40
- SDC4 Human, His$148.20
- BNP Human$570.00
- LB Agar Plate, Cam$20.00
- RELM b Human$90.00
- Cortisol ELISA (Mouse/Rat)$550.00
- Progesterone ELISA (Saliva)$300.00
- Human Leptin$357.60
- SEPT2 Human$75.00
- T.gondii p30$999.00
- DnaJ Human$148.20
- Testosterone ELISA$250.00
- Placental Lactogen Human$148.20
- HBsAg adw Mutant M-133-H$135.00
- BNP Human$90.00
- Flt3 Ligand Human, Sf9$148.20
- pHTS-hygro-MCS$540.00
- Plexin A1 ELISA, Rat$752.40
- IL 13 Mouse$148.20
- S100A1 Human$307.80
- PFN4 Human$148.20
- Prolactin ELISA (Mouse/Rat)$550.00
- Cortisol ELISA, Horse$860.00
- DNAJB8 Human$75.00
- Vimentin Human$4,104.00
- CFL1$957.60
- Der P1$684.00
- CPOX ELISA, Human$693.00
- KRT14 Human, His$90.00
- CD4 Antibody, Biotin$285.00
- pHTS-Neo-NFkB$540.00
- CCS Human$3,078.00
- α1-AGP ELISA, Mouse$562.60
- Placental Lactogen Human$2,394.00
- GH Mouse$2,736.00
- GH Human 20kDa$148.20
- IP 10 Mouse$90.00
- IL 1 beta Human, His$2,850.00
- ENA 78 Human (8-78 a.a.)$3,078.00
- CCL28 Human, His$4,104.00
- BMP 7 Human$4,104.00
- VEGF (121 a.a.) Human, Sf9$5,814.00
- ADIPOR1$793.80
- α Actin ELISA, Human$562.60
- Collagen-III Human$1,596.00
- SCF Human$148.20
- MOG$592.80
- APOA2 Human$148.20
- HEV ORF2 (633-659 a.a.)$1,198.80
- CST6 Human$90.00
- CLIC2 Human$90.00
- G CSF Human, CHO$90.00
- TARC Human, His$90.00
- pHTS-Neo-GAS$540.00
- LB Agar Plate, Amp/Tet$20.00
- SOD1 Human$75.00
- HCV Core 22kDa, Fluorescein$899.99
- FABP1 Human$75.00
- SDF 1a Human$90.00
- Omentin 298 a.a. Human$148.20
- IL 3 Dog$3,078.00
- pMEV Mammalian Expression Vector$234.00
- CALM2 Human$148.20
- EPO a Human, HEK$148.20
- ARF6 Human$90.00
- LGALS2 Human$90.00
- Leptin qA Ovine$90.00
- BNP Human, His$148.20
- TPO Human, CHO$148.20
- H1N1 Solomon Islands$1,998.00
- CRP Human Recombinant$239.40
- Estradiol Mab$301.50
- αFP ELISA, Rat$480.15
- Acrp30 Antibody$513.00
- pHTS-Neo-AP1$540.00
- SDF 1a Mouse$3,078.00
- HIV-1 Envelope$150.00
- pMEV2HA-NANOG$678.00
- Myostatin Human, His$4,104.00
- ALT$957.60
- EG VEGF Human$3,078.00
- PfHSP70$599.00
- LB Agar Plate, Cam$28.00
- CACYBP Human$148.20
- Leptin qA Human$90.00
- SNAPIN Human$75.00
- CD23 Human$307.80
- HGF A Human$5,472.00
- Scl-70 ELISA$250.00
- DnaJ E.Coli$1,140.00
- Resistin Human, His$4,195.20
- Zika Envelope, sf9$135.00
- SERPINA5 Human$5,928.00
- PF 4 Human$90.00
- BD 3 Mouse$3,078.00
- HEV ORF3$599.00
- INS ELISA, Dog$712.80
- CD28 Antibody$330.60
- APOM Human$90.00
- BAFF Human$5,335.20
- HGF Human CHO$148.20
- Myc Antibody$176.70
- AATF Antibody Pair, Human$999.99
- a1-AT ELISA, Rat$591.60
- STMN1 Human$3,078.00
- SARS MERS$150.00
- EBV p18 M$150.00
- Zika NS1$150.00
- H1N1 New Caledonia$1,998.00
- EEF1E1 Human$3,078.00
- AST$790.02
- APOH$793.80
- HIV-1 gp120 MN$1,798.20
- IL 27 Human$90.00
- BD 4 Rat$148.20
- Fish Cytochrome P450 1-->$860.00
- BD 2 Mouse$3,078.00
- NMM Human$75.00
- Corticosterone ELISA, Goat$860.00
- Total: $1,019,083.90CheckoutView Cart
Checkout

Catalog Number	Expression Host	Amount	In Stock
YP027127RA	Yeast	1mg	Quote
EP027127RA	E. coli	1mg	Quote
BP027127RA	Baculovirus	200ug	Quote
MP027127RA	Mammalian Cell	200ug	Quote

Species	Rattus norvegicus (Rat)
UniProt ID	O35986
Gene Name	Zranb2; aka: Zfp265, Zis, Znf265
Protein Name	Zinc finger Ran-binding domain-containing protein 2
Region Expressed	1-330
Expression Tag	6xHis
Purity	>90%
AA Sequence	MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKS RGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREES DGEYDEFGRKKKKYRGKAVGPASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADL SKYNLDASEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSR SHSGSREHSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSSPERDRKRSRSRPSSPAVRKK RRTRSRSPERHHRSSSGSTHSGSRSSSKKK
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Zinc finger Ran-bind-->

Request QuoteCatalog Number: xP027127RASize: 0.2-1mg

Recombinant Zinc finger Ran-binding domain-containing protein 2 (Zranb2)

Protein Information

Zinc finger Ran-bind-->