Request QuoteCatalog Number: xP365408FOZSize: 0.2-1mg

Request Quote

Recombinant Zinc-containing ferredoxin (zfx)

Recombinant Zinc-containing ferredoxin (zfx) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP365408FOZYeast1mgQuote
EP365408FOZE. coli1mgQuote
BP365408FOZBaculovirus200ugQuote
MP365408FOZMammalian Cell200ugQuote

Protein Information

SpeciesSulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
UniProt IDP00219
Gene Namezfx; Locus:Saci_0456
Protein NameZinc-containing ferredoxin
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceGIDPNYRTSKPVVGDHSGHKIYGPVESPKVLGVHGTIVGVDFDLCIADGSCITACPVNVF QWYETPGHPASEKKADPVNEQACIFCMACVNVCPVAAIDVKPP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review