Request QuoteCatalog Number: xP512952TMTSize: 0.2-1mg

Request Quote

Recombinant V-type ATP synthase subunit F (atpF)

Recombinant V-type ATP synthase subunit F (atpF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512952TMTYeast1mgQuote
EP512952TMTE. coli1mgQuote
BP512952TMTBaculovirus200ugQuote
MP512952TMTMammalian Cell200ugQuote

Protein Information

SpeciesThermococcus sibiricus (strain MM 739 / DSM 12597)
UniProt IDC6A5E9
Gene NameatpF; Locus:TSIB_1793
Protein NameV-type ATP synthase subunit F
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMKIVVLGDKDTVLGFRLAGVHETYSFEDTTHEIERVRNKIMELIEREDVGVILITERLAQ RVEIPDVAFPIILQIPDKYGSLYGEEQLREIVRRAIGVEIKR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review