Request QuoteCatalog Number: xP605281BUWSize: 0.2-1mg

Request Quote

Recombinant Zinc metalloproteinase-disintegrin bothrojarin-4

Recombinant Zinc metalloproteinase-disintegrin bothrojarin-4 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP605281BUWYeast1mgQuote
EP605281BUWE. coli1mgQuote
BP605281BUWBaculovirus200ugQuote
MP605281BUWMammalian Cell200ugQuote

Protein Information

SpeciesBothrops jararaca (Jararaca)
UniProt IDQ0NZX7
Gene Name
Protein NameZinc metalloproteinase-disintegrin bothrojarin-4
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceIVSPPVCGNYFVEVGEECDCGLPRNCQNQCCNATTCKLIPGAQCEDGECCERCQFKGAGN VCRPRRSKCDIAESCTGQSPDCPTDRFRRNGVSCLNN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review