Request QuoteCatalog Number: xP319847BIYSize: 0.2-1mg

Request Quote

Recombinant Zinc metalloproteinase-disintegrin leucurogin

Recombinant Zinc metalloproteinase-disintegrin leucurogin can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP319847BIYYeast1mgQuote
EP319847BIYE. coli1mgQuote
BP319847BIYBaculovirus200ugQuote
MP319847BIYMammalian Cell200ugQuote

Protein Information

SpeciesBothrops leucurus (White-tailed jararaca) (White-tailed lancehead)
UniProt IDP0DJ87
Gene Name
Protein NameZinc metalloproteinase-disintegrin leucurogin
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceLGTDIISPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSECGHGDCCEQCKFT KSGTECRASMSECDPAEHCTGQSSECPADVGHK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review