Request QuoteCatalog Number: xP526192DOASize: 0.2-1mg

Request Quote

Recombinant Zinc finger A20 and AN1 domain-containing stress-associated protein 9 (SAP9)

Recombinant Zinc finger A20 and AN1 domain-containing stress-associated protein 9 (SAP9) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526192DOAYeast1mgQuote
EP526192DOAE. coli1mgQuote
BP526192DOABaculovirus200ugQuote
MP526192DOAMammalian Cell200ugQuote

Protein Information

SpeciesArabidopsis thaliana (Mouse-ear cress)
UniProt IDO49663
Gene NameSAP9; Locus:At4g22820; ORFs:F7H19.10, T12H17.210
Protein NameZinc finger A20 and AN1 domain-containing stress-associated protein 9
Region Expressed1-176
Expression Tag6xHis
Purity>90%
AA SequenceMGSEQNDSTSFTQSQASEPKLCVKGCGFFGSPSNMDLCSKCYRGICAEEAQTAVAKAAVE KSFKPSPPRSLFIAEPPAVVVEPKPEKAAVVVVSAEPSSSAVPEANEPSRPARTNRCLCC NKKVGIMGFKCKCGSTFCGEHRYPETHDCSFDFKEVGRGEIAKANPVVKADKIQRF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review