Request QuoteCatalog Number: xP348020FPNSize: 0.2-1mg

Request Quote

Recombinant Zinc-containing ferredoxin-2 (zfx2)

Recombinant Zinc-containing ferredoxin-2 (zfx2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP348020FPNYeast1mgQuote
EP348020FPNE. coli1mgQuote
BP348020FPNBaculovirus200ugQuote
MP348020FPNMammalian Cell200ugQuote

Protein Information

SpeciesSulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
UniProt IDP58331
Gene Namezfx2; Locus:STK_11750
Protein NameZinc-containing ferredoxin-2
Region Expressed2-104
Expression Tag6xHis
Purity>90%
AA SequenceGIDPNYRQNRQVVGEHEGHKIYGPVEPPGKLGIHGTIVGVDFDVCIADGSCINACPVNVF QWFDTPGHPASEKKADPINEKACIFCMACVNVCPVAAIDVKPP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review