Request QuoteCatalog Number: xP312449YAQSize: 0.2-1mg

Request Quote

Recombinant Yop proteins translocation protein M (yscM)

Recombinant Yop proteins translocation protein M (yscM) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP312449YAQYeast1mgQuote
EP312449YAQE. coli1mgQuote
BP312449YAQBaculovirus200ugQuote
MP312449YAQMammalian Cell200ugQuote

Protein Information

SpeciesYersinia enterocolitica
UniProt IDQ01254
Gene NameyscM
Protein NameYop proteins translocation protein M
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEKAFASEVLEHVKNTALS RHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLLLEAAMRQDTAADG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review