Request QuoteCatalog Number: xP301732YASSize: 0.2-1mg

Request Quote

Recombinant Yop proteins translocation protein M (yscM)

Recombinant Yop proteins translocation protein M (yscM) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP301732YASYeast1mgQuote
EP301732YASE. coli1mgQuote
BP301732YASBaculovirus200ugQuote
MP301732YASMammalian Cell200ugQuote

Protein Information

SpeciesYersinia pestis
UniProt IDP69978
Gene NameyscM; aka: lcrQ; Locus:YPCD1.62, y5016, y0019, YP_pCD21
Protein NameYop proteins translocation protein M
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEKAFANEVLEHVKNTALS RHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLLLEAAMRQDTAADG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review