Request QuoteCatalog Number: xP304146SSQSize: 0.2-1mg

Request Quote

Recombinant Ycf20-like protein (sll1509)

Recombinant Ycf20-like protein (sll1509) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP304146SSQYeast1mgQuote
EP304146SSQE. coli1mgQuote
BP304146SSQBaculovirus200ugQuote
MP304146SSQMammalian Cell200ugQuote

Protein Information

SpeciesSynechocystis sp. (strain PCC 6803 / Kazusa)
UniProt IDP72983
Gene NameLocus:sll1509
Protein NameYcf20-like protein
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMQRTRLNTIVEVRGQQLSQFFRNPWRRISLSLLSFLFGFFVGTAVATTAGQNSQWDVVCA AFILLFCELVNRWFYRRGVKMGDLQAEVLNIFKMGVSYSLFLEAFKLGS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review