MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
20mM phosphate buffer pH 7.5.
Purified by proprietary chromatographic technique.
Protein is >95% pure as determined by SDS-PAGE.
Immunoreactive with sera of West Nile virus infected individuals.
WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Chromogranin A ELISA$550.00
Streptavidin$3,762.00
