Wiskott-Aldrich synd-->- Growth Factors, Growth Hormones, Purified Proteins, Dominant Negative Clones, Constitutively Active Clones- Lifeome

Company
Account
Cart: 1110 items : $1,045,983.25
- Total: $1,045,983.25CheckoutView Cart
- LIF Mouse$5,928.00
- SNRPD Human$75.00
- Adiponectin ELISA, Pig$728.00
- T.gondii p24$599.00
- Thrombin Human$3,762.00
- H1N1 California$1,798.20
- 8-epi-PGF2a ELISA, General$788.00
- HGF A Human$148.20
- PRL R Ovine$148.20
- Flt3 Ligand Human, HEK$148.20
- RPS3 Human$75.00
- BMP 4 Human$90.00
- α-La ELISA, Human$562.60
- SNCA A53T Human$75.00
- BNP ELISA, Canine$860.00
- TPM3 Human$148.20
- Transthyretin Human$148.20
- VEGF C Human$5,814.00
- T.pallidum p17 (Partial)$150.00
- FGF 1 Mouse$148.20
- LGALS10 Human$3,078.00
- Phospholipase A2$171.00
- TGF b 1 Human, GST$90.00
- HCV Core 22kDa, Fluorescein$899.99
- AICDA Antibody$148.20
- Alpl Antibody Pair, Mouse$999.99
- Dengue Envelope-1 22kDa$1,198.80
- REG1A Human$4,446.00
- Cortisol ELISA (Saliva)$300.00
- HCV NS3 antibody$1,482.00
- HCV Combined$599.00
- Exosome Isolation Kit, 2 Isolations$339.00
- MDC Mouse$148.20
- RAC1 Human, His$2,052.00
- IL 11 Human, Pichia$148.20
- Dengue Envelope-1 15kDa$599.00
- Leptin tA Mouse, PEG$148.20
- HIF1A Human, His$75.00
- Human NGAL Mab$301.50
- Leptin Human$513.00
- IFN g Antibody$330.60
- CST9 Human$90.00
- Calmodulin Human$148.20
- SSB IgG ELISA$250.00
- 8-OHdG ELISA, Mouse$905.00
- Leptin Rabbit$90.00
- IL 15 Rat$148.20
- Bcl 2 Human (minus BH2 domain)$90.00
- MBP Antibody$75.00
- GH Mouse$2,736.00
- CLIC1 Human$148.20
- Zika NS1, HEK$185.00
- T.pallidum p41$150.00
- Dengue Envelope-1 32kDa$1,198.80
- Thrombin Human$798.00
- LIF Mouse$148.20
- IFN a 1a Human$90.00
- RGS10 Human$75.00
- BAG1 Human$2,565.00
- TXN1 Yeast$75.00
- IL 2r Antibody$176.70
- CRP Human Recombinant$1,539.00
- AIF1$907.20
- IFNg ELISA, Rabbit$685.00
- AFP ELISA$350.00
- Leptin Pufferfish$148.20
- GM CSF Porcine$90.00
- MYL12A Human$148.20
- SNCA 96-140 Human$1,140.00
- RAB13 Human$75.00
- HIV-1 gag p17-p24, gp41-gp120$1,198.80
- RELM b Human$90.00
- AFP Human$199.50
- PFDN2 Human$75.00
- OSM Human, 209 a.a$5,335.20
- a-EBV-EA IgG ELISA, Human$665.00
- ADM ELISA, Horse$766.26
- HSV-1 gG$150.00
- VZV ORF26$999.00
- IGFBP 4 Human$148.20
- IFN a 1 Human$3,420.00
- SCF Human, Sf9$90.00
- MAP1LC3A Human$148.20
- Leptin Mouse, PEG$90.00
- ANXA2 Human$90.00
- CYP17A1 ELISA, Human$693.00
- Lymphotactin Human$3,078.00
- CD4 Antibody$330.60
- EBV p18$999.00
- CALB2 Mouse$307.80
- NME3 Human$75.00
- SNRNP70 Human$75.00
- FGF 21 Mouse$5,928.00
- F7 Human$148.20
- GST-cJun(1-79)$298.80
- Tricyclics ELISA$250.00
- 4 1BBR Human$3,078.00
- Collagen Human$1,596.00
- SMAD4 Human$148.20
- BAG2 Human$3,078.00
- CRYAA Antibody$513.00
- Human MST2, Set of 2$1,032.00
- HIV-1 gp120 antibody$330.60
- HAV VP1-P2A (722-830 a.a.)$599.00
- HCV Core Antibody$330.60
- COL4A3 Human$148.20
- VEGF Mouse, His$90.00
- pMEVHA-IKK1-KMAA$678.00
- α1-AGP ELISA, Human$562.60
- HIV-1 gag p17,p24, gp120$599.00
- APOA1 Human$1,482.00
- RBP4 Human$4,104.00
- BID Human$148.20
- His Tag Antibody$741.00
- αHBDH ELISA, Human$562.60
- MCFD2 Human$2,567.28
- HTLV-1 Envelope$150.00
- HBsAg adw Mutant G-145-R$185.00
- GH Bovine$90.00
- MAGEA3 Human$148.20
- TXN2 Human$148.20
- L Selectin Human$5,472.00
- HBV AG-2 antibody$330.60
- SARS Envelope$150.00
- PDGF AA Human, Yeast$90.00
- MAGEA1 Human$307.80
- pMEV2HA Mammalian Expression Vector$298.00
- GRO b Human$3,078.00
- Myo Human w/o H$148.20
- PCNA Human$148.20
- HMGB1 Human$2,052.00
- LGALS14 Human$148.20
- BMP4$1,008.00
- IL 11 Mouse$90.00
- NAPA Human$75.00
- CTGF Human, His$90.00
- Norovirus Group-1$599.00
- BTC Human$148.20
- OPG Human, His$2,736.00
- BD 2 Mouse$90.00
- VEGF Mouse$90.00
- TXNL1 Human$148.20
- EIF1 Human$5,928.00
- IL 8 Human (1-77)$90.00
- GRO b Human, His$148.20
- Streptavidin$75.00
- HCV 4th Generation 65kDa$599.00
- CRYBB1 Human$90.00
- Leptin Receptor Chicken$90.00
- aHSG ELISA, Bovine$748.44
- pMEVHA-JNKK1-K131M$678.00
- NGAL/MMP-9 ELISA, General$565.00
- CA-125 ELISA$350.00
- Lymphotactin Human$90.00
- CD4 Antibody, FITC$285.00
- pMEV2HA-YAP2-5SAdelC$678.00
- CTGF Human, HEK$90.00
- MCP 1 Rat$148.20
- RAC2 Human, 189a.a$3,078.00
- SDC4 Human, His$148.20
- B2M Human$171.00
- SCF Human$148.20
- EBI3 Mouse$148.20
- PfCs Mosaic$599.00
- REG1B Human$148.20
- pMEVHA-P38G-AA$678.00
- Adrenomedullin ELISA, Bovine$748.44
- FGF 1 Human, Sf9$5,928.00
- 4 1BBL Human$3,078.00
- SODA E.Coli$148.20
- pMEVHA-JNKK2-K149M$678.00
- Placental Lactogen Ovine$570.00
- HBV HBe$999.00
- PDRG1 Human$148.20
- Cannabinoids ELISA$250.00
- BID Antibody$90.00
- FN ELISA, Horse$766.26
- HIV-1 Envelope$150.00
- POU2AF1 Human$148.20
- 8-OHdG ELISA, General$480.15
- MAGEA3 Human$5,928.00
- FeLV$150.00
- PF 4 Human$148.20
- SCF Human, HEK$180.00
- SERPINA3 Human$148.20
- pMEVHA-IKK1-K44M$678.00
- REG1B Human$75.00
- AFP Human$307.80
- MYL2 Human$75.00
- IP 10 Rat$3,078.00
- pGH 22kDa Human$2,394.00
- HBV Pre-S$599.00
- CCKAR$957.60
- Free Triiodothyronine (fT3) ELISA$250.00
- CDC37 Human, His$90.00
- YWHAe ELISA, Human$693.00
- AHSG$148.20
- PDRG1 Human$3,078.00
- AREG$957.60
- Insulin ELISA$250.00
- T.gondii MIC-3$150.00
- Eotaxin Rat$3,078.00
- Trypsin Human, Yeast$75.00
- β-Glu ELISA, Mouse$562.60
- Leptin Human, His$90.00
- F8 Human$2,508.00
- PDGF B Human$148.20
- Omentin Human$5,928.00
- M.Pneumoniae P1-C$599.00
- SNCA 61-140 Human$1,140.00
- BMP2$1,058.40
- PDCD5 Human$75.00
- MDC Mouse$90.00
- GADD45B Human$148.20
- HMGB1 Human, Hi-5$4,104.00
- MYL5 (1-173 a.a.) Human$5,928.00
- C-Reactive Protein ELISA$350.00
- SDC4 Human, His$75.00
- pMEV2HA-IRAK4-WT$816.00
- FGF 2 Human (147 a.a.)$148.20
- CHGA Human$148.20
- ADAM10 Human$75.00
- RGS16 Human$5,928.00
- PfCs Mosaic$1,198.80
- IL 8 Porcine$90.00
- CCL16 Human$90.00
- CCL16 Human$3,078.00
- VEGF (121 a.a.) Human$148.20
- HIF1AN Human$75.00
- AMBP Human$148.20
- CST9 Human$3,078.00
- FGF6$1,260.00
- IL 8 Porcine$148.20
- CD14 Human, CHO$90.00
- α1ACT ELISA, Human$562.60
- Activin A Human Plant$90.00
- VEGF (121 a.a.) Human$3,990.00
- TPM2 Human$1,368.00
- HDV$150.00
- MIF Human$148.20
- SNAP25 Human$148.20
- AMBP ELISA, Rat$665.00
- CMV Pp28$150.00
- IL 8 Human, Pichia$148.20
- TFF3 Human$3,078.00
- KGF 2 Human$90.00
- Leptin Bovine$1,083.00
- EBV p18 M$1,198.80
- REG1A Human$148.20
- RAC2 Human$4,104.00
- pMEV2HA-cMYC$678.00
- α1BG ELISA, Human$562.60
- TFF1 Human, His$148.20
- 1F8 Chagas$185.00
- Myostatin Human$5,335.20
- HAV VP1$999.00
- CHGA Human, His$148.20
- PFDN5 Human$75.00
- SDF 1b Human, His$5,928.00
- BSA$228.00
- Vimentin Human$75.00
- Troponin I ELISA$350.00
- IFN a 1a Human$148.20
- ACTH ELISA, Rat$926.00
- U. Urealyticum$599.00
- MIP 1b Mouse$148.20
- a-HSP70 IgG ELISA, Human$765.00
- GH Denis$90.00
- H1N1 Solomon Islands$135.00
- SCF Rat$90.00
- SAA1 Human$1,482.00
- POU2AF1 Human$75.00
- SDCBP Human$148.20
- IFN b Mouse, His$3,078.00
- BMP 5 Human$90.00
- FGF 15 Mouse$5,928.00
- BID Mouse, GST$90.00
- CCS Human$3,078.00
- EGF ELISA, Rabbit$685.00
- PF 4 Mouse$3,306.00
- HIV-1 gp120 CM$235.00
- Cortisol ELISA, Goat$465.00
- IL 4 Porcine$148.20
- LGALS13 Human$148.20
- Fibronectin Bovine$1,083.00
- LB Agar Plate, Amp100$19.00
- MIP 1b Human$90.00
- GRO a Human, His$2,052.00
- Leptin tA Mouse, PEG$3,830.40
- AFG3L2 Antibody Pair, Human$999.99
- Leptin qA Human$1,915.20
- pMEV2HA-SOX2$678.00
- Endoglin Mouse$1,128.60
- Chlamydia W2$599.00
- HTLV-1 Envelope$999.00
- ANP ELISA, Simian$799.00
- MAPRE3 Human$3,078.00
- Der P1$1,140.00
- Fibronectin Rat$684.00
- IGF1 Human$307.80
- EEF1B2 Human$75.00
- AIMP1 Human$90.00
- Bcl 2 Human (minus BH1 domain)$90.00
- pHTS-hygro-ISRE$540.00
- FSH Ultra Sensitive CLIA$550.00
- CDC26 Human$148.20
- HBsAg adw Mutant M-133-H$1,198.80
- Leptin Mouse, PEG$3,249.00
- αHSP ELISA, Human$562.60
- MYL2 Human$3,420.00
- RBP4 Human$148.20
- LGALS2 Human$90.00
- Goat 1, 25-Dihydroxyvit-->$860.00
- Goat Albumin ELISA Kit-->$520.00
- CSTA Human$5,928.00
- A2M ELISA, Mouse$765.00
- pHTS-hygro-MCS$540.00
- α-KGDHC ELISA, Rat$562.60
- Myostatin Human, His$90.00
- EIF1 Human$148.20
- Myoglobin His Human$75.00
- SERPINA3 Human$75.00
- DDIT4 Human$90.00
- HPV 6$599.00
- Ang1-7$882.00
- SAA1 Monkey$148.20
- GADD45GIP1 Human$5,928.00
- pKG-cJun (1-79)$954.00
- ACTH ELISA, Goat$766.26
- EBI3 Mouse$5,928.00
- ALDOA Antibody Pair, Human$999.99
- Plant arachidonic Acid-->$860.00
- BNP ELISA, Pig$728.00
- Calmodulin Human$1,539.00
- ANXA13 Human$148.20
- Human JNK1, Set of 4$1,560.00
- AP2S1 Antibody Pair, Human$999.99
- Bovine (alpha) Lactalb-->$926.00
- IGFBP 1 Human$199.50
- Dengue Envelope-1 & 4$1,198.80
- Myc Antibody$741.00
- Borrelia Afzelii BmpA$185.00
- Ephrin A4 Human$558.60
- IGF1 Human Des1-3$1,368.00
- AMBP Human$513.00
- CMV Pp28$599.00
- Leptin Rabbit$148.20
- GH Chicken$148.20
- PRL R Human$148.20
- RBP4 Human, His$148.20
- BID Human$5,928.00
- IFN g Rat$90.00
- GH Human$90.00
- pMEV Mammalian Expression Vector$234.00
- APOA2 Human$1,026.00
- CALN1 Human$90.00
- TRAF2 Human$2,736.00
- PRL R Rabbit$148.20
- ADAM12 Human$75.00
- FGF 1 Human$1,539.00
- HCV Core 22kDa, Biotin$299.00
- BCA 1 Human$90.00
- FGF 19 Human$3,078.00
- Protein A, 434 a.a$2,736.00
- HSV-2 gG$150.00
- SARS Core (1-49,192-220 a.a.)$150.00
- FLAG Antibody$176.70
- HIV Type-O Envelope$999.00
- Leptin Ovine$1,083.00
- BAG3 Human$5,928.00
- Protein A, 41kDa$399.00
- TXN1 Human$2,052.00
- AGT$907.20
- Borrelia Afzelii p100$135.00
- Neuron Specific Enolase (NSE) ELISA for CSF$450.00
- PDGF AA Human, Yeast$148.20
- sRANKL Mouse$90.00
- ABL1 Antibody Pair, Human$999.99
- RPLP1 Human$148.20
- IL 1 beta Rat$90.00
- SARS Core (340-390 a.a.)$599.00
- BTC Bovine$148.20
- H1N1 Taiwan$185.00
- pMEV2HA-KRAS2B-G12V$678.00
- PfCs Mosaic$150.00
- SSA IgG ELISA$250.00
- BD 3 Antibody$330.60
- WNV Pre-M$599.00
- HAV P2C$150.00
- RBP5 Human$5,928.00
- TNF b Human, His$90.00
- pMEV2HA-IkBa-DN$678.00
- MAPRE1 Human$148.20
- βGD ELISA, Mouse$562.60
- RAC1 Human, His$148.20
- ANGPTL4 Human$148.20
- PCNA Human, GST$199.50
- Avidin Biotin$148.20
- IL 2 Porcine$90.00
- EBV EA$150.00
- LB Agar Plate, Carb$28.00
- ANG1 Antibody Pair, Bovine$999.99
- Thrombin Bovine$114.00
- HPCAL1 Human$5,928.00
- TPM4 Human$5,928.00
- Alpha 1-Antichymotrypsin (ACT) ELISA$450.00
- SOX9 Human$307.80
- CoV-229E$999.00
- Actb Antibody Pair, Mouse$999.99
- pMEV2HA-P38-EE$678.00
- SARS Core (340-390 a.a.)$150.00
- Placental Lactogen Ovine$148.20
- Leptin tA Mouse$90.00
- CALM2 Human$90.00
- HGF Human, HEK$90.00
- MIP 1a Human$296.40
- SMAD4 Human$150.00
- BMP10$1,814.40
- Actin$296.40
- Cortisol ELISA, Monkey$1,720.00
- TNC Human$1,026.00
- TNF b Human, His$148.20
- HPCAL1 Human$148.20
- SNCA A30P Human$1,140.00
- FGF 21 Mouse, His$5,472.00
- HIF1A Human (85 a.a.)$148.20
- S.Typhi H$1,198.80
- IL 11 Human$5,335.20
- HSV-2 gG$999.00
- SNRPD Human$148.20
- CD14 Mouse$199.50
- 2,3-BPG, ELISA, General$831.60
- BAG3 Human$148.20
- Streptavidin-NC$75.00
- C3 ELISA, Pig$665.00
- SNRNP25 Human$4,104.00
- HBV HBe$150.00
- PFN4 Human$75.00
- a-Actinin$148.20
- ANGPTL4 Human, HEK$90.00
- SAA4 Human$5,928.00
- MDC Rat$148.20
- Chlamydia W4$150.00
- CXCL4 Variant 1 Human$90.00
- Soybean P34 His$1,368.00
- a-RSV Ab ELISA, Mouse$665.00
- GH Bovine$148.20
- F3 Human$90.00
- SERPINA1 Human, Active$148.20
- Protein G$1,140.00
- MIF Human, Active$5,335.20
- EBI3 Human$5,928.00
- Neuron Specific Enolase (NSE) ELISA$450.00
- BTC Bovine$4,104.00
- CD4 Antibody, Biotin$285.00
- ANGPT1 Human$90.00
- Chlamydia W4$1,198.80
- RAC2 Human, 189a.a$75.00
- Collagen-III Human$980.40
- SCGN Human$5,928.00
- DBP ELISA, Horse$808.83
- KRT14 Human, His$90.00
- SOD1 Human$148.20
- Borrelia BmpA$185.00
- SNRPD Bovine$75.00
- Collagen Human$980.40
- Streptavidin-NC$148.20
- HCV Core 22kDa$599.00
- IFN a 2a Human, Plant$148.20
- PRL R Human, GST$558.60
- EIF1AY Human$148.20
- Human KRAS2B, Set of 3$1,194.00
- HIF1A Human$148.20
- Col1 ELISA, Horse$766.26
- SMAD2 Human$5,928.00
- Progesterone ELISA (Mouse/Rat)$550.00
- pMEV2HA-HRAS-S17N$678.00
- GH Antagonist Chicken$148.20
- MAGEA4 Human$148.20
- GHBP Ovine$3,830.40
- pMEVHA-KRAS2B-WT$678.00
- Westmark II for Western BlotRequest Quote
- SOD1 Human$3,078.00
- Myoglobin Human$456.00
- OPG Human, Hi-5$90.00
- pGH 22kDa Human$90.00
- MAPRE1 Human$75.00
- PRL R Ovine$3,830.40
- COL1 ELISA, Horse$805.83
- LSM4 Human$148.20
- Vimentin Bovine$148.20
- HA-HRP Antibody$661.20
- Triiodothyronine (T3) ELISA (Mouse/Rat)$550.00
- Borrelia Afzelii OspC$3,596.40
- CMV Pp65$599.00
- β-CTx ELISA, Rat$562.60
- Flt3 Ligand Human, Sf9$1,254.00
- 6HMS ELISA, Human$765.00
- FABP5 Human$4,104.00
- BD 1 Mouse$90.00
- Dengue Envelope-1 32kDa$599.00
- C-10 Rat$3,078.00
- ADAM17 ELISA, Mouse$765.00
- ANG-II ELISA, Dog$905.00
- GH Rat$290.70
- HA Antibody$330.60
- SIRT2 Human$75.00
- α1-AT ELISA, Mouse$562.60
- ANKRD50$907.20
- BRAK Human$3,078.00
- ACTL6A Human$148.20
- HSV-2 VP13/14$599.00
- Flt3 Ligand Human, Sf9$148.20
- SOD Human$148.20
- IL 10 Human, His$3,876.00
- pMEVHA-IKK2-KMAA$678.00
- Fibronectin Rat$148.20
- MIP 1a Mouse$3,078.00
- PFDN4 Human$148.20
- pMEV2HA-MEKK1-K452M$354.00
- GST antibody$330.60
- EBV p18, GST$1,498.50
- BAFF ELISA, Pig$790.02
- PRL R Human$3,830.40
- GH Ovine, Placental$90.00
- GroEL Antibody$513.00
- RAB11A Human$148.20
- Dengue type 2 Antibody$176.70
- HEV ORF2 (633-659 a.a.)$150.00
- TNC Human$90.00
- IL 1 alpha Human, His$3,648.00
- Thrombin Porcine$798.00
- HPV 18$150.00
- BAFF Antibody$75.00
- BAG1 Human$90.00
- DDIT3 Human$4,104.00
- SHH Mouse, His$148.20
- HAV VP1$150.00
- MAP1LC3A Human$75.00
- ProMark Native Protein MarkerRequest Quote
- Endoglin Human$199.50
- TXN1, His$75.00
- VEGF C Human$90.00
- C3a ELISA, Pig$748.44
- Hemoglobin ELISA, Horse$473.22
- GRO a Human$90.00
- ALCAM$793.80
- VSNL1 Human$2,052.00
- PDCD6 Human$148.20
- abscisic acid Mab$301.50
- AIF1$882.00
- Morphine ELISA (Canine)$550.00
- HBV core (1-183 a.a.)$1,198.80
- MV Large Polymerase 58-149 a.a$599.00
- FABP3 Human$148.20
- I TAC Human, His$90.00
- pMEV2HA-OCT3/4$678.00
- T.gondii p30$599.00
- TAGLN3 Human$148.20
- VEGF Human$4,001.40
- ANXA5 Human$90.00
- pMEVHA-P38G-K56M$678.00
- OSM Human, His$148.20
- IL 2 Antibody$176.70
- Placental Lactogen Bovine$570.00
- HTLV-1 mosaic$599.00
- pHTS-hygro-CRE$540.00
- AMH ELISA, Rat$860.00
- RAC3 Human$75.00
- pMEVHA-IKK2-EE$678.00
- Protein A$80.00
- MIP 1a Human$90.00
- TFF2 Human$148.20
- KRT18 Human, His$148.20
- HTF Bovine$570.00
- aLA ELISA, Dog$752.40
- Activin-A Human, HEK-Active$1,254.00
- MCP 1 Human$148.20
- Ang1-7 ELISA, Rat$765.00
- SNRNP70 Human$3,990.00
- Anti-HA monoclonal antibody$162.00
- LAG-1 Human$3,078.00
- HAV P3C$150.00
- GHBP Bovine$90.00
- CD4 Antibody, Biotin$456.00
- Leptin Human$90.00
- SDC1, GST Human$307.80
- F8 Human$1,014.60
- TNI Human$90.00
- PCNA Human, Sf9$148.20
- SDF 1a Rat$90.00
- HEV ORF3$1,198.80
- scIC2$5,928.00
- Phospholipase A2$684.00
- Amphiregulin ELISA, Bovine$748.44
- GST Antibody$75.00
- HCV NS3 antibody$1,254.00
- RPS14 Human$1,368.00
- KGF Human, HEK$148.20
- Leptin Pufferfish$90.00
- SCGN Rat$75.00
- EBV EBNA1$599.00
- IGFBP 5 Human$148.20
- TXN2 Human$75.00
- Chlamydia HSP70 (549-660a.a.)$150.00
- PDGF A Human$2,964.00
- H1N1 New Caledonia$135.00
- IL 13 Mouse$5,335.20
- GADD45GIP1 Human$148.20
- CRISPR-Gene Specific Duo Set-for KI$1,155.00
- Chlamydia pneumonia IgG ELISA$350.00
- PRL R Human, GST$307.80
- IL 1 beta Mouse$90.00
- pMEV2HA-MEK1-CA$678.00
- H. Pylori IgA ELISA$250.00
- VZV gE$150.00
- HTLV-1 Envelope$599.00
- SNCA 96-140 Human$148.20
- Angpt2 Antibody Pair, Mouse$999.99
- PF 4 Mouse$90.00
- IFN a 1b Human$148.20
- Leptin tA Mouse$1,915.20
- BMP 2 Antibody$330.60
- Fibronectin Human$1,083.00
- FABP1 Human$75.00
- BMP 5 Human$148.20
- OTUB2 Human$75.00
- HMGB1 Human, Hi-5$148.20
- VEGF D Human$90.00
- tBID Mouse$5,472.00
- SOD2 Human$75.00
- Exosome Isolation Kit, 10 Isolations$999.00
- Chlamydia PGP-3D$599.00
- EBV p18$150.00
- CRP (19-224 a.a) Human$148.20
- TGF b 1 Human, GST$1,140.00
- ACTG1 Human$5,472.00
- Dengue Envelope-1 & 4$599.00
- FLAG-HRP Antibody$661.20
- LGALS14 Human$1,254.00
- CRYAA Antibody$148.20
- HSV-2 gB$1,198.80
- pMEV2HA-LIN28$678.00
- H1N1 Beijing$185.00
- IFN a 2a Human, Plant$3,420.00
- CMV Pp38$150.00
- BAFF Human, His$148.20
- PF 4 Human$148.20
- TNF a Mutant Human$148.20
- EEF1E1 Human$148.20
- SDF 1b Human$148.20
- TNC Rabbit$912.00
- TXN1, His$148.20
- Leptin tA Rat, PEG$90.00
- GH Antagonist Ovine$90.00
- BMP7 Antibody$513.00
- scIC2$90.00
- RAC1 Human, His$75.00
- Leptin tA Rat$1,915.20
- BMP 7 Human, CHO$7,980.00
- H1N1 New Caledonia$135.00
- AATF Antibody Pair, Human$999.99
- MCP 1 Human, His$90.00
- Adenovirus IgG ELISA, Mouse$665.00
- NME4 Human$3,078.00
- H1N1 New Caledonia$235.00
- Eotaxin 2 Mouse$90.00
- TNF a Rat$90.00
- CRYBB1 Human$2,565.00
- CD23 Human$558.60
- Flunitrazepam ELISA$250.00
- FGF 2 Human (147 a.a.)$1,436.40
- Leptin tA Ovine$90.00
- BMP 2 Human$5,335.20
- CCKAR$1,008.00
- IFNa ELISA, Rabbit$728.00
- sRANKL Human, His$3,078.00
- IL 10 Porcine$1,482.00
- SNRNP25 Human$148.20
- HSV-1 gG$599.00
- β-EPR ELISA, Mouse$562.60
- NANOG Human, His$75.00
- TRAF1 Human$148.20
- Human Retinol-binding protein 4 Mab$301.50
- CALN1 Human$148.20
- HIV Type-O gp41$1,198.80
- CD2 Human$199.50
- HPV 6$150.00
- His Tag Antibody$176.70
- IGFBP 1 Human$558.60
- AICDA Antibody$513.00
- pMEV2HA-NRAS-WT$678.00
- ATF Bovine$2,508.00
- KRT14 Human$148.20
- C5a ELISA, Pig$860.00
- Bcl 2 Human (minus BH1 domain)$148.20
- Placental Lactogen Caprine$90.00
- MCP 1 Human$3,078.00
- FGF 9 Rat$4,001.40
- pMEV2HA-BRAF-ED$678.00
- SDF 1b Feline$148.20
- GH Mai Mai$90.00
- EFNB2 Human$3,078.00
- ENA 78 Human$90.00
- Transferrin Human$399.00
- BTC His Human$5,928.00
- RELM b Human$3,306.00
- KRT14 Human$90.00
- FSH ELISA, Goat$766.26
- pMEV2HA-cRAF1-wt$678.00
- Rantes Rat$148.20
- SNAPIN Human$148.20
- PDCD4 Human$148.20
- RELM b Mouse$90.00
- RELM a Mouse, His$148.20
- SNCA A30P/A53T Human$148.20
- GRO b Mouse$148.20
- RBP4 Human, His$90.00
- pMEV2HA-KRAS2A-S17N$678.00
- IGFBP 3 Human$148.20
- PFDN4 Human$75.00
- Chlamydia PGP-3D$1,198.80
- Insulin ELISA (Saliva)$450.00
- NME2 Human$148.20
- M CSF Mouse$148.20
- HMGB2 Human$75.00
- Omentin Human$148.20
- AFP ELISA, Rat$926.00
- SMAD3 Human$2,565.00
- MAPT Human$148.20
- OSM Human$148.20
- SARS Matrix$999.00
- a-dsDNA IgG ELISA, Mouse$765.00
- RNP/Sm IgG ELISA$250.00
- CDC37 Human, His$5,928.00
- SDF 1a Human, His$3,306.00
- LFA 3 Human$90.00
- POU5F1 Human$75.00
- FTL ELISA, Equine (Horse)$851.40
- DHH Human$90.00
- TXN1, His$5,928.00
- Leptin tA Ovine, PEG$148.20
- U. Urealyticum$150.00
- GRO b Rat$148.20
- pMEV2HA-NIK-T559M$678.00
- T.pallidum p41$999.00
- HSA$148.20
- pMEVHA-IKK1-WT$678.00
- BD 3 Human$90.00
- HA-HRP Antibody$359.10
- HIV-1 gag p17-p24, gp41-gp120$150.00
- SARS Envelope$999.00
- HMGB1 Human, Hi-5$75.00
- IL 8 Human (1-77), His$90.00
- Testosterone ELISA$250.00
- CSTA Human$90.00
- BAG2 Human$90.00
- Visfatin Human$90.00
- Rantes Mouse$3,078.00
- IGFBP 6 Human$148.20
- CDC26 Human$90.00
- Zika NS1, sf9$135.00
- HDGF Human$90.00
- IL 15 Rat$90.00
- AngII ELISA, Simian$801.90
- RBP7 Human$148.20
- NANOG-TAT Human$148.20
- CALB1 Rat$2,850.00
- TXN1 E.Coli$1,026.00
- Eptifibatide Human$444.60
- HAV P2C-P3A$599.00
- EBV-VCA IgM ELISA$250.00
- Noggin Mouse$90.00
- HEV ORF2 (403-461 a.a.)$599.00
- pMEVHA-JNKK2-WT$678.00
- CD31 Human$558.60
- IL 8 Human, Pichia$90.00
- α-SMA ELISA, Human$562.60
- pMEVHA-JNKK1-AA$678.00
- AITRL Human$90.00
- HIF1A Human (85 a.a.)$75.00
- ACE ELISA, Mouse$795.00
- MDC Human, His$2,052.00
- FsTnI Human$90.00
- HSA Recombinant, Plant$342.00
- ANGPTL4 Human$90.00
- FT4 ELISA, Goat$565.00
- RPS3 Human$148.20
- HCV Core Antibody$176.70
- Human NGAL Mab$301.50
- Ebola Zaire GP$599.00
- DCLK1 ELISA, Rat$784.08
- LeukinFeron Human$1,254.00
- pMEVHA-IKK2-WT$678.00
- IL 1 alpha Human, His$148.20
- ERP27 Human$5,928.00
- PF 4 Mouse$148.20
- Leptin Rat$90.00
- PDCD5 Human$148.20
- VEGF Rat$90.00
- Human IKK2, Set of 5$1,680.00
- IP 10 Rat$90.00
- Visfatin Human, His$148.20
- AIF1L Human$90.00
- TFF2 Human$3,078.00
- 15d-PGJ2 ELISA, General$480.15
- HIV-1 gp120 antibody$176.70
- ADAM10 Human$5,472.00
- pMEV2HA-AKT1-AA$678.00
- CYFRA21-1 ELISA, Monkey$693.00
- L Selectin Human$148.20
- ANXA1$882.00
- TPM4 Human$148.20
- RAB18 Human$75.00
- GH ELISA, Horse$766.26
- Vimentin Human, GST$558.60
- EBV EBNA1$150.00
- NME3 Human$148.20
- Dengue Envelope-1 & 4$150.00
- HTLV-1 gp21$150.00
- RPLP0 Human$75.00
- EPO a Human$90.00
- BHMT Antibody$148.20
- HEV ORF2 (452-617 a.a.)$150.00
- FGF 18 Mouse$3,078.00
- Hepatitis B antibody$330.60
- Vimentin Human, GST$307.80
- Dengue type 2 Antibody$330.60
- SEPT6 Human$75.00
- Bcl 2 Human (minus BH3 domain)$5,472.00
- SEPT5 Human$148.20
- RBP5 Human$148.20
- KRT20 Human$90.00
- IL 15 Mouse$4,001.40
- TNF a Rabbit$148.20
- Ferritin ELISA$350.00
- GH Gilthead Seabream$1,368.00
- CMV gB$999.00
- AITRL Human$3,078.00
- ANXA4 Human$90.00
- Leptin Receptor Human$148.20
- pMEV2HA-IRAK4-KA$816.00
- HGF Human CHO$5,016.00
- SARS-CoV-2 N Protein IgM ELISA$485.00
- Chlamydia W3-W6$150.00
- DnaJ Antibody$75.00
- RGS21 Human$75.00
- KIR2DL1 Human$148.20
- LIF Human, GST$148.20
- SNCA A53T Human$1,140.00
- IL 1 beta Rat$5,335.20
- OTUB1 Human$3,078.00
- CACYBP Human$148.20
- CLIC4 Human$4,104.00
- MYL6 (1-208 a.a.) Human$3,078.00
- Noggin Mouse$148.20
- ANG Antibody Pair, Human$999.99
- γ-Secretase ELISA, Rat$562.60
- α1-MG ELISA, Mouse$562.60
- LIF Human$90.00
- VEGF (121 a.a.) Mouse$90.00
- BAFF Human, Plant$148.20
- EBI3 Human$148.20
- IL 8 Human (1-77), His$2,508.00
- a-filaggrin Ab ELISA, Human$765.00
- LB Agar Plate, Carb/IPTG/Xgal$22.00
- MIP 1a Human, His$2,964.00
- pMEVHA-JNK1-AA$678.00
- sRANKL Human, His$90.00
- FGF 21 Mouse, His$148.20
- MCFD2 Human$148.20
- Angiopoietin 2 ELISA, Rat$685.00
- IGF2 Human$148.20
- SARS Core (340-390 a.a.)$999.00
- GM CSF Rat$3,334.50
- Noggin Human$148.20
- IL 10 Human$148.20
- TNF b Human$3,078.00
- CENPH Human$90.00
- ATF Human$456.00
- BMP 7 Human, CHO$148.20
- LGALS1 Human$1,539.00
- HAV P2C-P3A$999.00
- NME1 Human$3,078.00
- PFDN2 Human$5,928.00
- Fibronectin Bovine$148.20
- IL 1 alpha Human, His$90.00
- H1N1 California$135.00
- HGF B Human$90.00
- CENPH Human$3,078.00
- Westmark I for Western BlotRequest Quote
- Protein A$3,192.00
- LAB7-1 ELISA, Mouse$1,354.32
- Endoglin Human, Sf9$1,128.60
- Dengue Envelope-1 15kDa$150.00
- Shiga Like Toxin 2$1,198.80
- RAB1A Human$5,928.00
- Borrelia DbpB$185.00
- BMP2$907.20
- Leptin Mouse, PEG$148.20
- NAP 2 Human$90.00
- Protein A, 434 a.a$150.00
- A beta 1-42 ELISA, Human$860.00
- ANXA2 Human$2,565.00
- KIR2DS4 Human$148.20
- H1N1 Solomon Islands$235.00
- AMH ELISA, Bovine$1,852.00
- Leptin tA Human$296.40
- TFF3 Human, His$296.40
- VSNL1 Human$150.00
- RAB13 Human$296.40
- ERP27 Human$296.40
- TAGLN Human$5,130.00
- Omp Pylori$2,736.00
- BNP ELISA, Monkey$1,530.00
- a-CCP ELISA, Human$1,130.00
- CALB1 Human$2,052.00
- DDIT4 Human$148.20
- TAGLN3 Human$75.00
- Plant (Mouse-ear cress-->$860.00
- a-fibrillarin Abd ELISA, Human$765.00
- C-Peptide ELISA, Pig$765.00
- EBV EBNA1, His$1,498.50
- pGH 20kDa Human$90.00
- SNCA 1-60 Human$148.20
- EPO a Human$1,710.00
- Chimeric Chagas$299.05
- SNAP25 C.elegans$75.00
- Leptin Dog$148.20
- ANXA5 Human$2,565.00
- LFA 3 Human$969.00
- CABP7 Human$1,368.00
- CST6 Human$5,928.00
- CRYAB Antibody$148.20
- LB Agar Plate, Amp100$28.00
- HSP27 Antibody$148.20
- EPO a Human, HEK$90.00
- FGF 2 Rat$148.20
- NAPA Human$148.20
- NAP 2 Rat$148.20
- Dengue Envelope-1 & 3$1,198.80
- KRT20 Human$148.20
- F3 Human$148.20
- BRAK Human$90.00
- CD11b Human$558.60
- SARS-CoV-2 S1 RBD ELISA$533.50
- SARS-CoV-2 S RBD IgM, Human$765.00
- ARHGEF25$882.00
- FABP2 Human$2,850.00
- ANGPTL4 Human, HEK$5,472.00
- REG4 Human$4,446.00
- VEGF (121 a.a.) Human, Sf9$148.20
- scIC$90.00
- SCF Human, Sf9$148.20
- BMP 7 Human$90.00
- PfHSP70$1,198.80
- MDC Human, His$90.00
- CCL28 Human$148.20
- T.gondii p24$150.00
- RGS10 Human$148.20
- pMEVHA-IKK2-AA$678.00
- OPG Fc Human$148.20
- ANXA11 Human$90.00
- GST-HRP Antibody$359.10
- S100A1 Mouse$3,078.00
- CDC34 Human$90.00
- Flt3 Ligand Human$148.20
- Noggin Human, HEK$5,928.00
- SOX2 Human, PolyR$75.00
- IFN a 1 Human$90.00
- T.pallidum p15 (Partial), His$1,198.80
- TFF1 Human$90.00
- E Selectin Human$5,472.00
- HSA Recombinant, Plant$570.00
- SARS-CoV-2 Spike Protein IgM ELISA$485.00
- HDGF Human$4,104.00
- Protein A, 41kDa$80.00
- CCKAR$1,058.40
- Acrp30 Antibody$148.20
- αNAG ELISA, Mouse$562.60
- Lymphotactin Human, His$148.20
- APOA1 Human$90.00
- BLC1$907.20
- p53 Human, GST$307.80
- ANKRD50$882.00
- Cotinine ELISA$350.00
- pMEVHA-JNKK1-WT$678.00
- MIP 1a Rat$3,078.00
- APOA1$907.20
- MIA Human$148.20
- pMEV2HA-NIK-KKAA$678.00
- APAF1$907.20
- pMEVHA-JNKK2-EE$678.00
- pMEV2HA-AKT1-WT$678.00
- Dengue Virus IgM ELISA$350.00
- SDC4 Human$11,856.00
- PFN2 Human$75.00
- PSA ELISA$350.00
- TGF b 1 Human, GST$148.20
- ENA 78 Human (8-78 a.a.)$148.20
- HBV core delta$150.00
- Axin1 Antibody$148.20
- HDV$599.00
- FGF 21 Mouse$148.20
- bEP ELISA, Equine$766.26
- SARS Envelope$599.00
- Chlamydia W2$150.00
- a-MSH ELISA, Human$860.00
- Leptin Rat$148.20
- RPLP2 Human$4,788.00
- TGF b 1 (113 a.a.) Human$148.20
- Ebola Zaire GP$1,198.80
- H. Pylori IgG ELISA$250.00
- CTLA 4 Antibody$456.00
- MDC Rat$90.00
- A2M Human$148.20
- LB Agar Plate, Carb/IPTG/Xgal$30.00
- CALB1 Human$90.00
- BAFF R Human$90.00
- HSA Recombinant$1,083.00
- GRO a Human, His$148.20
- AHSG ELISA, Bovine$860.00
- FLAG-HRP Antibody$359.10
- Endoglin Human, Sf9$148.20
- EIF1 Human$75.00
- Mitochondrial (MA) Ab ELISA$250.00
- F7 ELISA, Rabbit$860.00
- HTLV-1 p24 core$599.00
- AREG$1,058.40
- EBV EBNA1$999.00
- Thrombin Bovine$74.10
- CSTB Human$148.20
- CCL28 Human$90.00
- 3-NT ELISA, General$480.15
- α-Fodrin IgG/IgA ELISA, Mouse$562.60
- BNP ELISA, Simian$799.90
- F9 Human$3,420.00
- HA-HRP Antibody$1,482.00
- ACTG1 Human$75.00
- β2-GP1 IgA/G/M ELISA, Mouse$562.60
- M.Pneumoniae P36$599.00
- pMEV2HA-IkBa-WT$678.00
- IL 1 alpha Human$5,335.20
- 1, 25 DHVD3 ELISA, Rat$565.00
- EVN Colonies Spreader$13.00
- LSM1 Human$75.00
- TAGLN Human$148.20
- Trypsin Human, Yeast$148.20
- ATF Human$285.00
- AGER Antibody Pair, Human$999.99
- MIP 1b Human$3,078.00
- CHGA Human, His$5,928.00
- PDGF B Human$2,964.00
- Myostatin Human, Plant$5,928.00
- OTUB2 Human$3,078.00
- HSV-1 IgG ELISA (Mouse/Rat)$550.00
- IP 10 Human$148.20
- TXNL1 Human$4,104.00
- AITRL Human$148.20
- HBV X$185.00
- KGF 2 Human$148.20
- IP 10 Human$90.00
- TNF a Mouse$3,078.00
- FTH1 Human$4,104.00
- Albumin ELISA, Bovine$790.02
- SDF 1b Feline$3,078.00
- Borrelia Afzelii BmpA$135.00
- GH Denis$148.20
- IGFBP 5 Human$90.00
- Shiga Like Toxin 1$1,198.80
- GADD45G Human$148.20
- ATOH1$882.00
- Trypsin Bovine$1,026.00
- SNAP25B Human$148.20
- HBsAg adw Mutant K-141-E$1,198.80
- MYL6 Human$148.20
- HCV Core 22kDa, Biotin$1,498.50
- hIFN-a$354.00
- GH Human$307.80
- CMV Pp150$999.00
- TPM1 Human$5,472.00
- I TAC Human$90.00
- ANXA3 Human$2,565.00
- ENO1 Antibody Pair, Human$999.99
- Aprotinin Bovine$148.20
- Aprotinin$307.80
- sCD4 Human$90.00
- CASQ2 Antibody$90.00
- CD72 Human$307.80
- Total: $1,045,983.25CheckoutView Cart
Checkout

Catalog Number	Expression Host	Amount	In Stock
YP025967MO	Yeast	1mg	Quote
EP025967MO	E. coli	1mg	Quote
BP025967MO	Baculovirus	200ug	Quote
MP025967MO	Mammalian Cell	200ug	Quote

Species	Mus musculus (Mouse)
UniProt ID	P70315
Gene Name	Was; aka: Wasp
Protein Name	Wiskott-Aldrich syndrome protein homolog
Region Expressed	1-520
Expression Tag	6xHis
Purity	>90%
AA Sequence	MNSGPGPVGGRPGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATTVVQLYLALP PGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFA GDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVP PHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADI GAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQG GLEAVRQEMRRQEPLPPPPPPCRGGGGGGGGGGGGGGGGGGQPLRPPVVGSNKGRSGPLP PVPMGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPP PPCPGSGPAPPPLPPTPVSGGSPAPGGGRGALLDQIRQGIQLNKTPGALENSVQQPPAQQ SEGLVGALMHVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Wiskott-Aldrich synd-->

Request QuoteCatalog Number: xP025967MOSize: 0.2-1mg

Recombinant Wiskott-Aldrich syndrome protein homolog (Was)

Protein Information

Wiskott-Aldrich synd-->