Request QuoteCatalog Number: xP518805MOSize: 0.2-1mg

Request Quote

Recombinant WAP four-disulfide core domain protein 6B (Wfdc6b)

Recombinant WAP four-disulfide core domain protein 6B (Wfdc6b) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518805MOYeast1mgQuote
EP518805MOE. coli1mgQuote
BP518805MOBaculovirus200ugQuote
MP518805MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDF6ULY1
Gene NameWfdc6b; aka: Wfdc6
Protein NameWAP four-disulfide core domain protein 6B
Region Expressed36-148
Expression Tag6xHis
Purity>90%
AA SequenceEGVFIRTCPKYNKIKCDFEERNQCLRHRECPGEERCCLFACGRKCLDLSEDICSLPQDAG PCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSICINKRKMSSWI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review