Voltage-dependent L--->

Request QuoteCatalog Number: xP004399CHSize: 0.2-1mg

Recombinant Voltage-dependent L-type calcium channel subunit alpha-1C (CACNA1C)

Recombinant Voltage-dependent L-type calcium channel subunit alpha-1C (CACNA1C) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP004399CH	Yeast	1mg	Quote
EP004399CH	E. coli	1mg	Quote
BP004399CH	Baculovirus	200ug	Quote
MP004399CH	Mammalian Cell	200ug	Quote

Protein Information

Species	Gallus gallus (Chicken)
UniProt ID	O73707
Gene Name	CACNA1C
Protein Name	Voltage-dependent L-type calcium channel subunit alpha-1C
Region Expressed	1-177
Expression Tag	6xHis
Purity	>90%
AA Sequence	ALIVVGSIVDIAITEVNNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQ ALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAW QEIMLACLPDKKCDPDSEPANSTEADHSCGSSFAVFYFISFYMLCAFLIIDLFVAVI
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products