Request QuoteCatalog Number: xP451468DLKSize: 0.2-1mg

Request Quote

Recombinant Vitelline membrane protein Vm32E (Vm32E)

Recombinant Vitelline membrane protein Vm32E (Vm32E) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP451468DLKYeast1mgQuote
EP451468DLKE. coli1mgQuote
BP451468DLKBaculovirus200ugQuote
MP451468DLKMammalian Cell200ugQuote

Protein Information

SpeciesDrosophila erecta (Fruit fly)
UniProt IDB3N4J9
Gene NameVm32E; ORFs:GG10317
Protein Name
Region Expressed18-113
Expression Tag6xHis
Purity>90%
AA SequenceSCPYAAPAVAPAAAPGYPAPPCPTNYLFSCQPNLAPVPCAQQAPAYGSAGAYTEQVPRYV ENPSREQLQRFHQRVGMAALMEELRGLGQGIQGQQY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review