Request QuoteCatalog Number: xP673847DDRSize: 0.2-1mg

Request Quote

Recombinant Virulence-associated protein I (vapI)

Recombinant Virulence-associated protein I (vapI) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP673847DDRYeast1mgQuote
EP673847DDRE. coli1mgQuote
BP673847DDRBaculovirus200ugQuote
MP673847DDRMammalian Cell200ugQuote

Protein Information

SpeciesDichelobacter nodosus (Bacteroides nodosus)
UniProt IDQ46560
Gene NamevapI
Protein NameVirulence-associated protein I
Region Expressed1-108
Expression Tag6xHis
Purity>90%
AA SequenceMSIPAGKNEMPAIHPGEILREEYLKPMGLSAHALAKALHVSPSRINEIVREQRGITADTA LRLVRYFGGDAQSWLNMQTAYDLKMAEQDKQSINIIIPLSTDARNVEL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review