Request QuoteCatalog Number: xP515397HUVSize: 0.2-1mg

Request Quote

Recombinant Virulence-associated protein D (vapD)

Recombinant Virulence-associated protein D (vapD) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515397HUVYeast1mgQuote
EP515397HUVE. coli1mgQuote
BP515397HUVBaculovirus200ugQuote
MP515397HUVMammalian Cell200ugQuote

Protein Information

SpeciesHelicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
UniProt IDO05728
Gene NamevapD; Locus:HP_0315
Protein NameVirulence-associated protein D
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMYALAFDLKIEILKKEYGEPYNKAYDDLRQELELLGFEWTQGSVYVNYSKENTLAQVYKA INKLSQIEWFKKSVRDIRAFKVEDFSDFTEIVKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review