Request QuoteCatalog Number: xP303075VAISize: 0.2-1mg

Request Quote

Recombinant Virion membrane protein A21 (VACWR140)

Recombinant Virion membrane protein A21 (VACWR140) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP303075VAIYeast1mgQuote
EP303075VAIE. coli1mgQuote
BP303075VAIBaculovirus200ugQuote
MP303075VAIMammalian Cell200ugQuote

Protein Information

SpeciesVaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )
UniProt IDP68712
Gene NameLocus:VACWR140; ORFs:A21L
Protein NameVirion membrane protein A21
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMITLFLILCYFILIFNIIVPAISEKMRRERAAYVNYKRLNKNFICVDDRLFSYNFTTSGI KAKVAVDNKNVPIPCSKINEVNNNKDVDTLYCDKDRDDIPGFARSCYRAYSDLFFTT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review