Request QuoteCatalog Number: xP324114VAASize: 0.2-1mg

Request Quote

Recombinant Virion membrane protein A14 (A14L)

Recombinant Virion membrane protein A14 (A14L) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP324114VAAYeast1mgQuote
EP324114VAAE. coli1mgQuote
BP324114VAABaculovirus200ugQuote
MP324114VAAMammalian Cell200ugQuote

Protein Information

SpeciesVaccinia virus (strain Copenhagen) (VACV)
UniProt IDP20991
Gene NameORFs:A14L
Protein NameVirion membrane protein A14
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMDMMLMIGNYFSGVLIAGIILLILSCIFAFIDFSKSTSPTRTWKVLSIMAFILGIIITVG MLIYSMWGKHCAPHRVSGVIHTNHSDISMN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review