Request QuoteCatalog Number: xP300768AEJSize: 0.2-1mg

Request Quote

Recombinant Viral histone-like protein (BA71V-033)

Recombinant Viral histone-like protein (BA71V-033) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP300768AEJYeast1mgQuote
EP300768AEJE. coli1mgQuote
BP300768AEJBaculovirus200ugQuote
MP300768AEJMammalian Cell200ugQuote

Protein Information

SpeciesAfrican swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
UniProt IDP68742
Gene NameLocus:BA71V-033; ORFs:A104R
Protein NameViral histone-like protein
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMSTKKKPTITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIPPGIKFTV VTVKAKPARQGHNPATGEPIQIKAKPEHKAVKIRALKPVHDMLN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review