Request QuoteCatalog Number: xP391991BOSize: 0.2-1mg

Request Quote

Recombinant VEGF co-regulated chemokine 1 (CXCL17)

Recombinant VEGF co-regulated chemokine 1 (CXCL17) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP391991BOYeast1mgQuote
EP391991BOE. coli1mgQuote
BP391991BOBaculovirus200ugQuote
MP391991BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDA4IFR0
Gene NameCXCL17; aka: VCC1
Protein NameVEGF co-regulated chemokine 1
Region Expressed23-118
Expression Tag6xHis
Purity>90%
AA SequenceSSHTGVARGQRDQRQASGRWLREGGQECECQDWFLRAPRRTLMAAPRLTKPCPCDHFKGR MKKTRHQRHHRKSNKPSRACQQFLTRCLLESFALPL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review