Request QuoteCatalog Number: xP386838BPUSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP386838BPUYeast1mgQuote
EP386838BPUE. coli1mgQuote
BP386838BPUBaculovirus200ugQuote
MP386838BPUMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia pseudomallei (strain 668)
UniProt IDA3NCL5
Gene NameureA; Locus:BURPS668_3074
Protein NameUrease subunit gamma
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMKLTPREKDKLLIFTAALLAERRRARGLKLNYPETVAFITAALMEAARDGRTVAEVMHYG TTLLTRDDVMEGVPEMIPDIQVEATFPDGTKLVTVHHPIP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review