Request QuoteCatalog Number: xP509605TLRSize: 0.2-1mg

Request Quote

Recombinant Urease subunit gamma (ureA)

Recombinant Urease subunit gamma (ureA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509605TLRYeast1mgQuote
EP509605TLRE. coli1mgQuote
BP509605TLRBaculovirus200ugQuote
MP509605TLRMammalian Cell200ugQuote

Protein Information

SpeciesTeredinibacter turnerae (strain ATCC 39867 / T7901)
UniProt IDC6AR50
Gene NameureA; Locus:TERTU_4208
Protein NameUrease subunit gamma
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMELSPREKDKLLIFTAALLAERRKEKGLKLNYPESIALISAAIMEGAREGKTVAELMDFG RTILSRDDVMEGIAEMIHDVQVEATFPDGTKLVTVHEPIV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review