Request QuoteCatalog Number: xP510931TLRSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510931TLRYeast1mgQuote
EP510931TLRE. coli1mgQuote
BP510931TLRBaculovirus200ugQuote
MP510931TLRMammalian Cell200ugQuote

Protein Information

SpeciesTeredinibacter turnerae (strain ATCC 39867 / T7901)
UniProt IDC5BUP0
Gene NameureB; Locus:TERTU_4207
Protein NameUrease subunit beta
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEYDIKDGEITLNENRKTLTLTVANTGDRPIQVGSHYHFFETNPALSFSRDATRGFR LNIAAGTAVRFEPGQDREVELVEIAGDKTVYGFRGEIMGELEGGSHE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review