Request QuoteCatalog Number: xP502406RKXSize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP502406RKXYeast1mgQuote
EP502406RKXE. coli1mgQuote
BP502406RKXBaculovirus200ugQuote
MP502406RKXMammalian Cell200ugQuote

Protein Information

SpeciesRhizobium sp. (strain NGR234)
UniProt IDC3MGX4
Gene NameureB; Locus:NGR_c25030
Protein NameUrease subunit beta
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEIIAAAGDIELNGGLPTITIEVSNSGDRPVQVGSHYHFAETNPGLIFDRDAARGRR LDIPAGTAVRFEPGQTRQVTLIPLSGKREVFGFRQQVMGKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review