Request QuoteCatalog Number: xP453375AXISize: 0.2-1mg

Request Quote

Recombinant Urease subunit beta (ureB)

Recombinant Urease subunit beta (ureB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP453375AXIYeast1mgQuote
EP453375AXIE. coli1mgQuote
BP453375AXIBaculovirus200ugQuote
MP453375AXIMammalian Cell200ugQuote

Protein Information

SpeciesActinobacillus pleuropneumoniae serotype 7 (strain AP76)
UniProt IDB3H2L4
Gene NameureB; Locus:APP7_1679
Protein Name
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMIPGEYQLADGDVQANVGRKTVKLEVVNSGDRPIQVGSHYHFFETNHALKFDRLQARGMR LNVPSGNAVRFEPGEAKEVELVEFGGNKVIYGFHNEIDGKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review