Request QuoteCatalog Number: xP509897AYXSize: 0.2-1mg

Request Quote

Recombinant UPF0767 protein C1orf212 homolog (PANDA_005386)

Recombinant UPF0767 protein C1orf212 homolog (PANDA_005386) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509897AYXYeast1mgQuote
EP509897AYXE. coli1mgQuote
BP509897AYXBaculovirus200ugQuote
MP509897AYXMammalian Cell200ugQuote

Protein Information

SpeciesAiluropoda melanoleuca (Giant panda)
UniProt IDD2H617
Gene NameORFs:PANDA_005386
Protein NameUPF0767 protein C1orf212 homolog
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDE LLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review