Request QuoteCatalog Number: xP516829MWSSize: 0.2-1mg

Request Quote

Recombinant UPF0767 protein C1orf212 homolog

Recombinant UPF0767 protein C1orf212 homolog can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP516829MWSYeast1mgQuote
EP516829MWSE. coli1mgQuote
BP516829MWSBaculovirus200ugQuote
MP516829MWSMammalian Cell200ugQuote

Protein Information

SpeciesMyotis lucifugus (Little brown bat)
UniProt IDG1QDE8
Gene Name
Protein NameUPF0767 protein C1orf212 homolog
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDE LLGKDHTQVLSLKDKLEFAPKAVLNRNRPEKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review