Request QuoteCatalog Number: xP518923DOSize: 0.2-1mg

Request Quote

Recombinant UPF0767 protein C1orf212 homolog

Recombinant UPF0767 protein C1orf212 homolog can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518923DOYeast1mgQuote
EP518923DOE. coli1mgQuote
BP518923DOBaculovirus200ugQuote
MP518923DOMammalian Cell200ugQuote

Protein Information

SpeciesCanis familiaris (Dog) (Canis lupus familiaris)
UniProt IDE2R5I0
Gene Name
Protein NameUPF0767 protein C1orf212 homolog
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPAEEEKSISERREDRKLDE LLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review