Request QuoteCatalog Number: xP503325BQFSize: 0.2-1mg

Request Quote

Recombinant UPF0738 protein BAA_1286 (BAA_1286)

Recombinant UPF0738 protein BAA_1286 (BAA_1286) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP503325BQFYeast1mgQuote
EP503325BQFE. coli1mgQuote
BP503325BQFBaculovirus200ugQuote
MP503325BQFMammalian Cell200ugQuote

Protein Information

SpeciesBacillus anthracis (strain A0248)
UniProt IDC3P3Q0
Gene NameLocus:BAA_1286
Protein NameUPF0738 protein BAA_1286
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVS IPHTCWEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review