Request QuoteCatalog Number: xP494536FMYSize: 0.2-1mg

Request Quote

Recombinant UPF0473 protein SPN23F01880 (SPN23F01880)

Recombinant UPF0473 protein SPN23F01880 (SPN23F01880) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP494536FMYYeast1mgQuote
EP494536FMYE. coli1mgQuote
BP494536FMYBaculovirus200ugQuote
MP494536FMYMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
UniProt IDB8ZKE6
Gene NameLocus:SPN23F01880
Protein NameUPF0473 protein SPN23F01880
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVLLVPVNAEEDEDGQVE IQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review