Request QuoteCatalog Number: xP510097EJOSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein NT01EI_1174 (NT01EI_1174)

Recombinant UPF0345 protein NT01EI_1174 (NT01EI_1174) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510097EJOYeast1mgQuote
EP510097EJOE. coli1mgQuote
BP510097EJOBaculovirus200ugQuote
MP510097EJOMammalian Cell200ugQuote

Protein Information

SpeciesEdwardsiella ictaluri (strain 93-146)
UniProt IDC5BHN8
Gene NameLocus:NT01EI_1174
Protein NameUPF0345 protein NT01EI_1174
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMLNVNEYFAGKVKSIGYDSGSIGRASVGVMEKGEYTFTTDRPEEMTVVTGALRVLIPGAP DWQVFTPGETFFVPERSEFNLQVAEPSAYLCKYLS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review