Request QuoteCatalog Number: xP510468GFRSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein GM21_1187 (GM21_1187)

Recombinant UPF0345 protein GM21_1187 (GM21_1187) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510468GFRYeast1mgQuote
EP510468GFRE. coli1mgQuote
BP510468GFRBaculovirus200ugQuote
MP510468GFRMammalian Cell200ugQuote

Protein Information

SpeciesGeobacter sp. (strain M21)
UniProt IDC6E375
Gene NameLocus:GM21_1187
Protein NameUPF0345 protein GM21_1187
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMSEFNNVSVVKEANIYFDGKVTSRTVIFPDGSRKTLGVMLPGEYTFNTGSAELMEILSGE MTVVLPGSPDPVAIKGGEAFEVPENASFKVNVTAVSDYICSFL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review