Request QuoteCatalog Number: xP496629FMISize: 0.2-1mg

Request Quote

Recombinant UPF0298 protein SEQ_1830 (SEQ_1830)

Recombinant UPF0298 protein SEQ_1830 (SEQ_1830) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP496629FMIYeast1mgQuote
EP496629FMIE. coli1mgQuote
BP496629FMIBaculovirus200ugQuote
MP496629FMIMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. equi (strain 4047)
UniProt IDC0M7M6
Gene NameLocus:SEQ_1830
Protein NameUPF0298 protein SEQ_1830
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMFQKQQRIGLVIYLYYNRDARKVMKYGDLYYHSRRSRYLVIYINKEDMEEKLKDISRLTF VKEVKVSAFDDIDCDFVGNLHREPLEPQALPEQG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review