Request QuoteCatalog Number: xP511749GFJSize: 0.2-1mg

Request Quote

Recombinant UPF0295 protein GWCH70_0499 (GWCH70_0499)

Recombinant UPF0295 protein GWCH70_0499 (GWCH70_0499) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511749GFJYeast1mgQuote
EP511749GFJE. coli1mgQuote
BP511749GFJBaculovirus200ugQuote
MP511749GFJMammalian Cell200ugQuote

Protein Information

SpeciesGeobacillus sp. (strain WCH70)
UniProt IDC5D5W1
Gene NameLocus:GWCH70_0499
Protein NameUPF0295 protein GWCH70_0499
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMGIKYSSKINKIRTFALSLIFVGFIVMYIGIFFRTSPFVMTLFMILGLLFIIASTVVYFW IGTLSTRAVKVVCPSCGKITKMLGKVDLCMFCNEPLTLDPELEGKEFDEKYNRKKRKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review