Request QuoteCatalog Number: xP422366BOLSize: 0.2-1mg

Request Quote

Recombinant UPF0295 protein BPUM_0828 (BPUM_0828)

Recombinant UPF0295 protein BPUM_0828 (BPUM_0828) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP422366BOLYeast1mgQuote
EP422366BOLE. coli1mgQuote
BP422366BOLBaculovirus200ugQuote
MP422366BOLMammalian Cell200ugQuote

Protein Information

SpeciesBacillus pumilus (strain SAFR-032)
UniProt IDA8FB95
Gene NameLocus:BPUM_0828
Protein NameUPF0295 protein BPUM_0828
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMAKYSSKINKIRTFALSLVFVGFLIMYIGVFFKESIWLSTFFMLLGVLSIGLSTVVYFWI GMLSTKAVRVVCPGCEKETKVLGRVDMCMHCREPLTLDPGLEGKEFDESYNRKKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review