Request QuoteCatalog Number: xP525913DSBSize: 0.2-1mg

Request Quote

Recombinant UPF0235 protein CT_388 (CT_388)

Recombinant UPF0235 protein CT_388 (CT_388) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP525913DSBYeast1mgQuote
EP525913DSBE. coli1mgQuote
BP525913DSBBaculovirus200ugQuote
MP525913DSBMammalian Cell200ugQuote

Protein Information

SpeciesChlamydia trachomatis (strain D/UW-3/Cx)
UniProt IDO84393
Gene NameLocus:CT_388
Protein NameUPF0235 protein CT_388
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMRFLLKLLSKEKENILLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDA VVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSIKAFLLEQFPSESSSTTGKKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review