Request QuoteCatalog Number: xP513010ESQSize: 0.2-1mg

Request Quote

Recombinant UPF0231 protein PC1_3552 (PC1_3552)

Recombinant UPF0231 protein PC1_3552 (PC1_3552) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513010ESQYeast1mgQuote
EP513010ESQE. coli1mgQuote
BP513010ESQBaculovirus200ugQuote
MP513010ESQMammalian Cell200ugQuote

Protein Information

SpeciesPectobacterium carotovorum subsp. carotovorum (strain PC1)
UniProt IDC6DED2
Gene NameLocus:PC1_3552
Protein NameUPF0231 protein PC1_3552
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMDYEFLRDVTGQVIVRMSMGHEAIGHWFNEEVKGQLTVLTDVEEAARSVAGSERQWRRVG HEYTLSLDEEEVMVQANQLSFTTDELEEGMSYYDEESLSLCGLDDFLTLVEKYREFVLH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review