Request QuoteCatalog Number: xP514842ESQSize: 0.2-1mg

Request Quote

Recombinant UPF0213 protein PC1_0597 (PC1_0597)

Recombinant UPF0213 protein PC1_0597 (PC1_0597) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514842ESQYeast1mgQuote
EP514842ESQE. coli1mgQuote
BP514842ESQBaculovirus200ugQuote
MP514842ESQMammalian Cell200ugQuote

Protein Information

SpeciesPectobacterium carotovorum subsp. carotovorum (strain PC1)
UniProt IDC6DKL5
Gene NameLocus:PC1_0597
Protein NameUPF0213 protein PC1_0597
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMTEHIEHPQWYLYILRTITGALYTGITTDVSRRLNQHQTGKGAKALRGKGELTLVFHCLA GDRSNALKLEYRIKQLSKNQKERLVQDQPQTLCISDTMY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review