Request QuoteCatalog Number: xP516188DOCSize: 0.2-1mg

Request Quote

Recombinant UPF0212 protein AF_0282 (AF_0282)

Recombinant UPF0212 protein AF_0282 (AF_0282) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP516188DOCYeast1mgQuote
EP516188DOCE. coli1mgQuote
BP516188DOCBaculovirus200ugQuote
MP516188DOCMammalian Cell200ugQuote

Protein Information

SpeciesArchaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
UniProt IDO29959
Gene NameLocus:AF_0282
Protein NameUPF0212 protein AF_0282
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMPDYLVVLQAAWIVRKARSVEDAMNIAVAEAGKKLNPDLDFVKIDVGDTACPKCNSPLKA VFMVAGVALVGLIFEMKVFNAKSPEHAAKIAKYEIGKRMPRIPLEVIEVAEIE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review