Request QuoteCatalog Number: xP524100DNVSize: 0.2-1mg

Request Quote

Recombinant UPF0166 protein aq_450 (aq_450)

Recombinant UPF0166 protein aq_450 (aq_450) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP524100DNVYeast1mgQuote
EP524100DNVE. coli1mgQuote
BP524100DNVBaculovirus200ugQuote
MP524100DNVMammalian Cell200ugQuote

Protein Information

SpeciesAquifex aeolicus (strain VF5)
UniProt IDO66758
Gene NameLocus:aq_450
Protein NameUPF0166 protein aq_450
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMRVVKKKLLRIFTSEDESFEGKPFYKYLLERAKERGLEGATVFRAIAGYGKTKEIRKHKL FQLRSSLPVVVEIIDEEEKIKRFLEEIKGKHNGLITLEDVEVIYL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review