Request QuoteCatalog Number: xP499639EUASize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein PERMA_0324 (PERMA_0324)

Recombinant UPF0145 protein PERMA_0324 (PERMA_0324) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP499639EUAYeast1mgQuote
EP499639EUAE. coli1mgQuote
BP499639EUABaculovirus200ugQuote
MP499639EUAMammalian Cell200ugQuote

Protein Information

SpeciesPersephonella marina (strain DSM 14350 / EX-H1)
UniProt IDC0QTV2
Gene NameLocus:PERMA_0324
Protein NameUPF0145 protein PERMA_0324
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMIITTTDFIEGKKIRDYKGVVSKEAVIGVNIIRDVFAKVRDIVGGRSAAYEKELTNARNQ ILEELKEEARNLGANAVIGINFSYEMYQSMLLVSVWGTAVVVE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review