Request QuoteCatalog Number: xP510406ESQSize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein PC1_1703 (PC1_1703)

Recombinant UPF0145 protein PC1_1703 (PC1_1703) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510406ESQYeast1mgQuote
EP510406ESQE. coli1mgQuote
BP510406ESQBaculovirus200ugQuote
MP510406ESQMammalian Cell200ugQuote

Protein Information

SpeciesPectobacterium carotovorum subsp. carotovorum (strain PC1)
UniProt IDC6DEQ9
Gene NameLocus:PC1_1703
Protein NameUPF0145 protein PC1_1703
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMQLSTTPTLEGFTITEYCGVVTGEAILGANIFRDFFASIRDVVGGRSGAYEKELRKARQI AFKELQEQAADLGANAVVGIDLDYETVGKDGSMLMVTVSGTAVKVRR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review