Request QuoteCatalog Number: xP522935MSRSize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein MTH_544 (MTH_544)

Recombinant UPF0145 protein MTH_544 (MTH_544) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522935MSRYeast1mgQuote
EP522935MSRE. coli1mgQuote
BP522935MSRBaculovirus200ugQuote
MP522935MSRMammalian Cell200ugQuote

Protein Information

SpeciesMethanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
UniProt IDO26644
Gene NameLocus:MTH_544
Protein NameUPF0145 protein MTH_544
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMVEEHRDVIYVTSNYVPGYRAVEVLGFVYGLTVRSRRLGGQIDRFKSILGGEIKEYVTMM EHSRQEALERMLDHARELGANAVISVRFDSDSISDIMQEILAYGTAVIVEPEE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review