Request QuoteCatalog Number: xP383994DUTSize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein Cthe_0398 (Cthe_0398)

Recombinant UPF0145 protein Cthe_0398 (Cthe_0398) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP383994DUTYeast1mgQuote
EP383994DUTE. coli1mgQuote
BP383994DUTBaculovirus200ugQuote
MP383994DUTMammalian Cell200ugQuote

Protein Information

SpeciesClostridium thermocellum (strain ATCC 27405 / DSM 1237)
UniProt IDA3DCF7
Gene NameLocus:Cthe_0398
Protein NameUPF0145 protein Cthe_0398
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMIITTTNGIEGKRVVEYKGIVCGEVISGVDFIKDFAAGLTNFFGGRSKSYEGELIEAREG AIREMKERAIQMGANAIIGVDIDYEVLGQGGNMLMVTASGTAVVIE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review