Request QuoteCatalog Number: xP387871AUFSize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein APL_0465 (APL_0465)

Recombinant UPF0145 protein APL_0465 (APL_0465) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP387871AUFYeast1mgQuote
EP387871AUFE. coli1mgQuote
BP387871AUFBaculovirus200ugQuote
MP387871AUFMammalian Cell200ugQuote

Protein Information

SpeciesActinobacillus pleuropneumoniae serotype 5b (strain L20)
UniProt IDA3MZI3
Gene NameLocus:APL_0465
Protein NameUPF0145 protein APL_0465
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMIITTTPTIDGHQITEYKGLVFGEVVSGANFIRDFFASITDVIGGRSGAYESKLNSARQE ALAELEKEAKRVGANAVVGVSMEYQSMGGDKGMFIVVATGTAVVIR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review