Request QuoteCatalog Number: xP387317SURSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein SSA_0326 (SSA_0326)

Recombinant UPF0133 protein SSA_0326 (SSA_0326) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP387317SURYeast1mgQuote
EP387317SURE. coli1mgQuote
BP387317SURBaculovirus200ugQuote
MP387317SURMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus sanguinis (strain SK36)
UniProt IDA3CKS8
Gene NameLocus:SSA_0326
Protein NameUPF0133 protein SSA_0326
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMMNMQSMMKQAQKLQKQMEKGQAELAATEFTGKSAQDLVVAKLTGDKKVVSIDFNPAVVD PEDLETLSEMTAQALNHALAQIDDATQKKMGAFAGKLPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review