Request QuoteCatalog Number: xP527878MVNSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein ML2330 (ML2330)

Recombinant UPF0133 protein ML2330 (ML2330) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP527878MVNYeast1mgQuote
EP527878MVNE. coli1mgQuote
BP527878MVNBaculovirus200ugQuote
MP527878MVNMammalian Cell200ugQuote

Protein Information

SpeciesMycobacterium leprae
UniProt IDO69519
Gene NameLocus:ML2330; ORFs:MLCB2407.20
Protein NameUPF0133 protein ML2330
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSGEVVSVAIDPK VVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAMRPTAPPPTPPTYMAGT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review