Request QuoteCatalog Number: xP513267EOWSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein EUBELI_02017 (EUBELI_02017)

Recombinant UPF0133 protein EUBELI_02017 (EUBELI_02017) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513267EOWYeast1mgQuote
EP513267EOWE. coli1mgQuote
BP513267EOWBaculovirus200ugQuote
MP513267EOWMammalian Cell200ugQuote

Protein Information

SpeciesEubacterium eligens (strain ATCC 27750 / VPI C15-48)
UniProt IDC4Z4W1
Gene NameLocus:EUBELI_02017
Protein NameUPF0133 protein EUBELI_02017
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMAKRGGFPGGMPGNMNNLMKQAQRMQRQMEEQQAELENKEFSATAGGGVVEVTVTGKREV SKVKIDPEAVDPDDVEMLEDLIVAATNEALRKCEEESQAQMAKITGGLGGLGGGLF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review