Request QuoteCatalog Number: xP309476FMRSize: 0.2-1mg

Request Quote

Recombinant UPF0122 protein SMU_1061 (ylxM)

Recombinant UPF0122 protein SMU_1061 (ylxM) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP309476FMRYeast1mgQuote
EP309476FMRE. coli1mgQuote
BP309476FMRBaculovirus200ugQuote
MP309476FMRMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus mutans
UniProt IDP96468
Gene NameylxM; Locus:SMU_1061
Protein NameUPF0122 protein SMU_1061
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFDVSRQAVYDNIKRTE KILEDYEMKLHMYSDYVVRSEIFDAIMKKYPNDPYLQNKISILTTIDNRD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review